StarFunc result for job id P22681

User Input

>input (906 residues)
MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCW
KLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFME
NLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFR
ITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFE
FDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRL
GQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDH
IKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVER
PPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLR
DLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPV
SAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPECD
HPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRAC
DCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPP
VPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSC
QQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISS
PAHVAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0U1RR39	0.353	0.370	0.000	862	0.951	1.000	A0A0U1RR39.pdb.gz	A0A0U1RR39_HUMAN E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=1
2	AFDB:P22682	0.469	0.466	0.000	913	0.933	0.926	P22682.pdb.gz	CBL_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cbl PE=1 SV=3
3	AFDB:Q98TY6	0.355	0.356	3.591E-103	903	0.838	0.841	Q98TY6.pdb.gz	Q98TY6_CHICK E3 ubiquitin-protein ligase CBL OS=Gallus gallus OX=9031 PE=2 SV=1
4	AFDB:A0A0U1ZFN5	0.369	0.394	1.197E-98	846	0.853	0.914	A0A0U1ZFN5.pdb.gz	A0A0U1ZFN5_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
5	AFDB:F1QI90	0.454	0.451	3.774E-93	913	0.722	0.716	F1QI90.pdb.gz
6	AFDB:Q13191	0.480	0.444	7.346E-74	982	0.513	0.474	Q13191.pdb.gz	CBLB_HUMAN E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens OX=9606 GN=CBLB PE=1 SV=2
7	AFDB:B9EKI5	0.356	0.344	2.364E-72	938	0.525	0.507	B9EKI5.pdb.gz	B9EKI5_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cblb PE=1 SV=1
8	AFDB:Q9VSK2	0.445	0.459	4.161E-63	878	0.430	0.444	Q9VSK2.pdb.gz	Q9VSK2_DROME E3 ubiquitin-protein ligase CBL OS=Drosophila melanogaster OX=7227 GN=Cbl PE=2 SV=2
9	AFDB:Q9ULV8	0.428	0.793	8.186E-46	474	0.236	0.451	Q9ULV8.pdb.gz	CBLC_HUMAN E3 ubiquitin-protein ligase CBL-C OS=Homo sapiens OX=9606 GN=CBLC PE=1 SV=3
10	AFDB:Q19019	0.419	0.647	3.087E-45	582	0.253	0.393	Q19019.pdb.gz	Q19019_CAEEL E3 ubiquitin-protein ligase CBL OS=Caenorhabditis elegans OX=6239 GN=sli-1 PE=1 SV=1
11	PDB:1k9aB	0.081	0.158	5.254E-2	441	0.014	0.029	1k9aB.pdb.gz
12	PDB:3ps5A	0.073	0.117	9.695E-2	529	0.021	0.036	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
13	PDB:5xzrA	0.072	0.123	9.695E-2	519	0.012	0.021	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
14	PDB:4k2rA	0.081	0.129	1.130E-1	551	0.020	0.033	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:4gwfA	0.076	0.132	1.189E-1	497	0.015	0.028	4gwfA.pdb.gz
16	PDB:4fl2A	0.063	0.101	1.535E-1	555	0.014	0.023	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
17	PDB:1ka6A	0.057	0.437	2.430E-1	107	0.012	0.103	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
18	PDB:4r8pL	0.059	0.191	2.558E-1	254	0.025	0.091	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
19	PDB:1griA	0.060	0.243	2.691E-1	211	0.009	0.038	1griA.pdb.gz
20	PDB:3e46A	0.048	0.201	2.981E-1	202	0.015	0.069	3e46A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A061I5T4	0.0	1182	934	0.720	0.698	A0A061I5T4_CRIGR E3 ubiquitin-protein ligase CBL (Fragment) OS=Cricetulus griseus OX=10029 GN=H671_4g13114 PE=1 SV=1
2	A0A0U1RR39	0.0	1766	862	0.951	1.000	A0A0U1RR39_HUMAN E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=1
3	A0A0U1ZFN5	0.0	790	846	0.439	0.470	A0A0U1ZFN5_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
4	A0A8I5ZWU2	0.0	607	802	0.368	0.415	A0A8I5ZWU2_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
5	A0A8I6AFF7	0.0	1434	825	0.831	0.913	A0A8I6AFF7_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
6	A0A8I6G3R2	0.0	1571	914	0.921	0.912	A0A8I6G3R2_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
7	A0A8I6G861	0.0	1483	870	0.880	0.916	A0A8I6G861_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
8	B9EKI5	0.0	744	938	0.409	0.396	B9EKI5_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cblb PE=1 SV=1
9	D3ZV15	0.0	1485	894	0.861	0.872	D3ZV15_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=2
10	O46034	0.0	640	448	0.326	0.658	O46034_DROME E3 ubiquitin-protein ligase CBL OS=Drosophila melanogaster OX=7227 GN=Cbl PE=2 SV=1
11	P22681	0.0	1872	906	1.000	1.000	CBL_HUMAN E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2
12	P22682	0.0	1593	913	0.928	0.921	CBL_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cbl PE=1 SV=3
13	P91683	0.0	637	448	0.325	0.656	P91683_DROME E3 ubiquitin-protein ligase CBL OS=Drosophila melanogaster OX=7227 GN=Cbl PE=2 SV=1
14	Q13191	0.0	735	982	0.467	0.431	CBLB_HUMAN E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens OX=9606 GN=CBLB PE=1 SV=2
15	Q3TTA7	0.0	745	982	0.407	0.376	CBLB_MOUSE E3 ubiquitin-protein ligase CBL-B OS=Mus musculus OX=10090 GN=Cblb PE=1 SV=3
16	Q5U376	0.0	1149	913	0.715	0.710	Q5U376_DANRE E3 ubiquitin-protein ligase CBL OS=Danio rerio OX=7955 GN=wu:fd16a12 PE=2 SV=1
17	Q8K4S7	0.0	744	938	0.409	0.396	CBLB_RAT E3 ubiquitin-protein ligase CBL-B OS=Rattus norvegicus OX=10116 GN=Cblb PE=1 SV=1
18	Q98TY6	0.0	1479	903	0.837	0.839	Q98TY6_CHICK E3 ubiquitin-protein ligase CBL OS=Gallus gallus OX=9031 PE=2 SV=1
19	Q9VSK2	0.0	652	878	0.333	0.344	Q9VSK2_DROME E3 ubiquitin-protein ligase CBL OS=Drosophila melanogaster OX=7227 GN=Cbl PE=2 SV=2
20	Q6ABG8	3.89e-156	470	523	0.242	0.419	Q6ABG8_CAEEL E3 ubiquitin-protein ligase CBL OS=Caenorhabditis elegans OX=6239 GN=sli-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02262 Cbl_N	2e-50	181.3	CBL proto-oncogene N-terminal domain 1
2	PF02761 Cbl_N2	1.8e-38	142.4	CBL proto-oncogene N-terminus, EF hand-like domain
3	PF02762 Cbl_N3	1.6e-44	160.9	CBL proto-oncogene N-terminus, SH2-like domain
4	PF14447 Prok-RING_4	1e-10	52.6	Prokaryotic RING finger family 4
5	PF00627 UBA	0.025	25.7	UBA/TS-N domain
6	PF00097 zf-C3HC4	2e-05	35.6	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	0.19	22.9	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	4.3e-07	41.0	Zinc finger, C3HC4 type (RING finger)
9	PF15227 zf-C3HC4_4	2.2e+02	13.4	zinc finger of C3HC4-type, RING
10	PF12678 zf-rbx1	99	14.7	RING-H2 zinc finger domain
11	PF13639 zf-RING_2	0.00012	33.7	Ring finger domain
12	PF14634 zf-RING_5	21	16.5	zinc-RING finger domain
13	PF13445 zf-RING_UBOX	0.94	20.9	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264033

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000046794	0.999	Lymphocyte cytosolic protein 2
2	9606.ENSP00000244007	0.999	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
3	9606.ENSP00000264972	0.999	Tyrosine-protein kinase ZAP-70
4	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
5	9606.ENSP00000300574	0.999	Adapter molecule crk
6	9606.ENSP00000317272	0.999	Hepatocyte growth factor receptor
7	9606.ENSP00000346300	0.999	Crk-like protein
8	9606.ENSP00000346671	0.999	Tyrosine-protein kinase Fyn
9	9606.ENSP00000352264	0.999	CD2-associated protein
10	9606.ENSP00000360293	0.999	Sorbin and SH3 domain-containing protein 1
11	9606.ENSP00000362680	0.999	Proto-oncogene tyrosine-protein kinase Src
12	9606.ENSP00000364907	0.999	Tyrosine-protein kinase SYK
13	9606.ENSP00000366306	0.999	Protein sprouty homolog 2
14	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
15	9606.ENSP00000380921	0.999	SH3 domain-containing kinase-binding protein 1
16	9606.ENSP00000381717	0.999	Ubiquitin-conjugating enzyme E2 D2
17	9606.ENSP00000428056	0.999	Phosphatidylinositol 3-kinase regulatory subunit alpha
18	9606.ENSP00000472929	0.999	Proto-oncogene vav
19	9606.ENSP00000337825	0.998	Tyrosine-protein kinase Lck
20	9606.ENSP00000351209	0.998	Ephrin type-A receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017124	1.000	SH3 domain binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0019901	0.999	protein kinase binding
GO:1990782	0.994	protein tyrosine kinase binding
GO:0043548	0.982	phosphatidylinositol 3-kinase binding
GO:0005102	0.834	signaling receptor binding
GO:0046875	0.454	ephrin receptor binding
GO:0036312	0.301	phosphatidylinositol 3-kinase regulatory subunit binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051716	0.996	cellular response to stimulus
GO:0032446	0.996	protein modification by small protein conjugation
GO:0007154	0.994	cell communication
GO:0050794	0.993	regulation of cellular process
GO:0006513	0.993	protein monoubiquitination
GO:0032418	0.992	lysosome localization
GO:0002444	0.992	myeloid leukocyte mediated immunity
GO:0010332	0.992	response to gamma radiation
GO:0045576	0.992	mast cell activation
GO:0002275	0.992	myeloid cell activation involved in immune response
GO:0043299	0.992	leukocyte degranulation
GO:0033574	0.991	response to testosterone
GO:0000209	0.989	protein polyubiquitination
GO:0070997	0.987	neuron death
GO:0048519	0.987	negative regulation of biological process
GO:0046677	0.987	response to antibiotic
GO:1990090	0.987	cellular response to nerve growth factor stimulus
GO:0008584	0.987	male gonad development
GO:0051865	0.986	protein autoubiquitination
GO:0036119	0.985	response to platelet-derived growth factor
GO:0036120	0.983	cellular response to platelet-derived growth factor stimulus
GO:0048523	0.981	negative regulation of cellular process
GO:0014823	0.977	response to activity
GO:0006950	0.977	response to stress
GO:0070887	0.972	cellular response to chemical stimulus
GO:0060548	0.966	negative regulation of cell death
GO:0071496	0.930	cellular response to external stimulus
GO:0097305	0.923	response to alcohol
GO:0033554	0.891	cellular response to stress
GO:0070482	0.870	response to oxygen levels
GO:0051656	0.863	establishment of organelle localization
GO:0031667	0.860	response to nutrient levels
GO:0023052	0.857	signaling
GO:0048522	0.857	positive regulation of cellular process
GO:0007165	0.850	signal transduction
GO:0031668	0.825	cellular response to extracellular stimulus
GO:0071453	0.823	cellular response to oxygen levels
GO:1901214	0.813	regulation of neuron death
GO:0048583	0.808	regulation of response to stimulus
GO:1901215	0.798	negative regulation of neuron death
GO:0045471	0.786	response to ethanol
GO:0036294	0.785	cellular response to decreased oxygen levels
GO:0009966	0.742	regulation of signal transduction
GO:1902531	0.693	regulation of intracellular signal transduction
GO:0044237	0.636	cellular metabolic process
GO:0007166	0.618	cell surface receptor signaling pathway
GO:0042594	0.615	response to starvation
GO:0031669	0.564	cellular response to nutrient levels
GO:0006974	0.530	cellular response to DNA damage stimulus
GO:0019222	0.514	regulation of metabolic process
GO:0048584	0.473	positive regulation of response to stimulus
GO:0060255	0.405	regulation of macromolecule metabolic process
GO:0031323	0.376	regulation of cellular metabolic process
GO:0007167	0.360	enzyme-linked receptor protein signaling pathway
GO:0080090	0.337	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0045121	0.980	membrane raft
GO:0005829	0.980	cytosol
GO:0120025	0.972	plasma membrane bounded cell projection
GO:0043229	0.951	intracellular organelle
GO:0043227	0.946	membrane-bounded organelle
GO:0030054	0.931	cell junction
GO:0043231	0.913	intracellular membrane-bounded organelle
GO:0012505	0.906	endomembrane system
GO:0070161	0.852	anchoring junction
GO:0150034	0.848	distal axon
GO:0030055	0.832	cell-substrate junction
GO:0005925	0.804	focal adhesion
GO:0030427	0.710	site of polarized growth
GO:0030426	0.701	growth cone
GO:0048471	0.671	perinuclear region of cytoplasm
GO:0032991	0.421	protein-containing complex
GO:0005634	0.314	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]