StarFunc result for job id P22692

User Input

>input (258 residues)
MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCA
LGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDE
GDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHR
ALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGG
LEPKGELDCHQLADSFRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22692	1.000	1.000	3.137E-54	258	1.000	1.000	P22692.pdb.gz	IBP4_HUMAN Insulin-like growth factor-binding protein 4 OS=Homo sapiens OX=9606 GN=IGFBP4 PE=1 SV=2
2	AFDB:P24593	0.516	0.494	3.874E-22	272	0.411	0.390	P24593.pdb.gz	IBP5_HUMAN Insulin-like growth factor-binding protein 5 OS=Homo sapiens OX=9606 GN=IGFBP5 PE=1 SV=1
3	AFDB:P18065	0.360	0.291	4.403E-22	325	0.403	0.320	P18065.pdb.gz	IBP2_HUMAN Insulin-like growth factor-binding protein 2 OS=Homo sapiens OX=9606 GN=IGFBP2 PE=1 SV=2
4	AFDB:P13384	0.346	0.287	5.687E-22	317	0.403	0.328	P13384.pdb.gz	IBP2_BOVIN Insulin-like growth factor-binding protein 2 OS=Bos taurus OX=9913 GN=IGFBP2 PE=1 SV=2
5	AFDB:P47877	0.343	0.297	7.345E-22	305	0.407	0.344	P47877.pdb.gz	IBP2_MOUSE Insulin-like growth factor-binding protein 2 OS=Mus musculus OX=10090 GN=Igfbp2 PE=2 SV=2
6	AFDB:B3F211	0.564	0.551	8.348E-22	265	0.357	0.347	B3F211.pdb.gz	IBP2B_DANRE Insulin-like growth factor-binding protein 2-B OS=Danio rerio OX=7955 GN=igfbp2b PE=1 SV=1
7	AFDB:Q9PTH3	0.581	0.549	4.132E-21	276	0.345	0.322	Q9PTH3.pdb.gz	IBP2A_DANRE Insulin-like growth factor-binding protein 2-A OS=Danio rerio OX=7955 GN=igfbp2a PE=1 SV=1
8	AFDB:Q90WV8	0.504	0.494	1.307E-20	265	0.364	0.355	Q90WV8.pdb.gz	IBP5_XENLA Insulin-like growth factor-binding protein 5 OS=Xenopus laevis OX=8355 GN=igfbp5 PE=2 SV=1
9	AFDB:P17936	0.611	0.548	2.642E-20	291	0.364	0.323	P17936.pdb.gz	IBP3_HUMAN Insulin-like growth factor-binding protein 3 OS=Homo sapiens OX=9606 GN=IGFBP3 PE=1 SV=2
10	AFDB:A0A0B5JK49	0.522	0.515	5.010E-20	262	0.384	0.378	A0A0B5JK49.pdb.gz
11	PDB:7wrqB	0.486	0.706	1.891E-12	167	0.295	0.455	7wrqB.pdb.gz
12	PDB:5epmC	0.076	0.521	2.981	33	0.023	0.182	5epmC.pdb.gz
13	PDB:1a0lA	0.092	0.096	3.178	244	0.023	0.025	1a0lA.pdb.gz	Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.
14	PDB:1u8wA	0.069	0.106	3.612	149	0.035	0.060	1u8wA.pdb.gz
15	PDB:6w2xB	0.088	0.042	3.851	669	0.070	0.027	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
16	PDB:6b1uA	0.081	0.057	4.974	442	0.066	0.038	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:3craA	0.091	0.097	5.302	239	0.047	0.050	3craA.pdb.gz
18	PDB:7kpxC	0.080	0.022	5.302	1352	0.101	0.019	7kpxC.pdb.gz
19	PDB:3mp8A	0.103	0.070	5.653	513	0.074	0.037	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
20	PDB:2eyzA	0.066	0.073	6.026	304	0.105	0.089	2eyzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P22692	0.0	521	258	1.000	1.000	IBP4_HUMAN Insulin-like growth factor-binding protein 4 OS=Homo sapiens OX=9606 GN=IGFBP4 PE=1 SV=2
2	P47879	9.29e-163	452	254	0.907	0.921	IBP4_MOUSE Insulin-like growth factor-binding protein 4 OS=Mus musculus OX=10090 GN=Igfbp4 PE=1 SV=2
3	P21744	6.40e-162	450	254	0.903	0.917	IBP4_RAT Insulin-like growth factor-binding protein 4 OS=Rattus norvegicus OX=10116 GN=Igfbp4 PE=1 SV=2
4	Q8JHX6	1.72e-51	170	262	0.422	0.416	Q8JHX6_DANRE Insulin-like growth factor-binding protein 1 OS=Danio rerio OX=7955 GN=igfbp1a PE=2 SV=1
5	Q90YJ7	1.23e-50	168	262	0.422	0.416	Q90YJ7_DANRE Insulin-like growth factor-binding protein 1 OS=Danio rerio OX=7955 GN=IGFBP-1 PE=2 SV=1
6	Q07079	1.67e-47	160	271	0.426	0.406	IBP5_MOUSE Insulin-like growth factor-binding protein 5 OS=Mus musculus OX=10090 GN=Igfbp5 PE=1 SV=1
7	P24594	3.47e-47	159	271	0.426	0.406	IBP5_RAT Insulin-like growth factor-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Igfbp5 PE=1 SV=1
8	B3GS77	2.20e-46	157	271	0.407	0.387	B3GS77_SHEEP Insulin-like growth factor-binding protein 5 OS=Ovis aries OX=9940 GN=IGFBP5 PE=2 SV=1
9	Q05717	1.85e-45	155	271	0.391	0.373	IBP5_BOVIN Insulin-like growth factor-binding protein 5 OS=Bos taurus OX=9913 GN=IGFBP5 PE=2 SV=2
10	P24593	2.53e-45	155	272	0.388	0.368	IBP5_HUMAN Insulin-like growth factor-binding protein 5 OS=Homo sapiens OX=9606 GN=IGFBP5 PE=1 SV=1
11	Q90WV8	6.63e-45	154	265	0.391	0.381	IBP5_XENLA Insulin-like growth factor-binding protein 5 OS=Xenopus laevis OX=8355 GN=igfbp5 PE=2 SV=1
12	P21743	1.54e-43	150	272	0.372	0.353	IBP1_RAT Insulin-like growth factor-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Igfbp1 PE=1 SV=2
13	P47876	2.47e-43	150	272	0.364	0.346	IBP1_MOUSE Insulin-like growth factor-binding protein 1 OS=Mus musculus OX=10090 GN=Igfbp1 PE=2 SV=2
14	P47877	5.29e-42	147	305	0.372	0.315	IBP2_MOUSE Insulin-like growth factor-binding protein 2 OS=Mus musculus OX=10090 GN=Igfbp2 PE=2 SV=2
15	B3F211	8.38e-42	145	265	0.341	0.332	IBP2B_DANRE Insulin-like growth factor-binding protein 2-B OS=Danio rerio OX=7955 GN=igfbp2b PE=1 SV=1
16	Q9PTH3	2.20e-41	145	276	0.364	0.341	IBP2A_DANRE Insulin-like growth factor-binding protein 2-A OS=Danio rerio OX=7955 GN=igfbp2a PE=1 SV=1
17	P12843	8.52e-41	144	304	0.368	0.312	IBP2_RAT Insulin-like growth factor-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Igfbp2 PE=1 SV=3
18	P13384	4.60e-40	142	317	0.395	0.322	IBP2_BOVIN Insulin-like growth factor-binding protein 2 OS=Bos taurus OX=9913 GN=IGFBP2 PE=1 SV=2
19	Q29400	4.80e-40	142	317	0.395	0.322	IBP2_SHEEP Insulin-like growth factor-binding protein 2 OS=Ovis aries OX=9940 GN=IGFBP2 PE=2 SV=1
20	M4Q8Z6	5.76e-40	140	245	0.345	0.363	M4Q8Z6_SALSA Insulin-like growth factor-binding protein 1 OS=Salmo salar OX=8030 GN=IGFBP-1B1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00219 IGFBP	5.9e-07	41.3	Insulin-like growth factor binding protein
2	PF00086 Thyroglobulin_1	3.7e-16	69.8	Thyroglobulin type-1 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000009656

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000004843	0.992	Insulin-like growth factor 1 (somatomedin C)
2	9593.ENSGGOP00000003893	0.943	Insulin-like growth factor 2 (somatomedin A)
3	9593.ENSGGOP00000010446	0.918	Insulin-like growth factor binding protein 1
4	9593.ENSGGOP00000006962	0.884	Pappalysin 1
5	9593.ENSGGOP00000002058	0.779	Low-density lipoprotein receptor-related protein
6	9593.ENSGGOP00000005802	0.777	Frizzled class receptor 5
7	9593.ENSGGOP00000018178	0.674	Pappalysin 2
8	9593.ENSGGOP00000009504	0.673	Caldesmon 1
9	9593.ENSGGOP00000006421	0.670	Protein Wnt
10	9593.ENSGGOP00000022620	0.664	Phospholipase A2, group X
11	9593.ENSGGOP00000012281	0.660	Collagen, type IV, alpha 2
12	9593.ENSGGOP00000024836	0.585	Low-density lipoprotein receptor-related protein
13	9593.ENSGGOP00000025853	0.585	LDL receptor related protein 5 like
14	9593.ENSGGOP00000016564	0.557	Sialic acid binding Ig-like lectin 1, sialoadhesin
15	9593.ENSGGOP00000010544	0.530	Frizzled class receptor 7
16	9593.ENSGGOP00000005738	0.528	RNA binding motif (RNP1, RRM) protein 3
17	9593.ENSGGOP00000024814	0.525	Progesterone receptor
18	9593.ENSGGOP00000000431	0.522	Frizzled class receptor 1
19	9593.ENSGGOP00000006663	0.522	Frizzled class receptor 2
20	9593.ENSGGOP00000017962	0.522	Protein Wnt

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005520	0.998	insulin-like growth factor binding
GO:0005102	0.977	signaling receptor binding
GO:0031994	0.659	insulin-like growth factor I binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0051716	0.947	cellular response to stimulus
GO:0023052	0.933	signaling
GO:0007154	0.930	cell communication
GO:0023051	0.920	regulation of signaling
GO:0007165	0.919	signal transduction
GO:0010646	0.916	regulation of cell communication
GO:0048583	0.910	regulation of response to stimulus
GO:0009966	0.880	regulation of signal transduction
GO:0048519	0.817	negative regulation of biological process
GO:0048523	0.724	negative regulation of cellular process
GO:0030111	0.676	regulation of Wnt signaling pathway
GO:0023057	0.672	negative regulation of signaling
GO:0010648	0.671	negative regulation of cell communication
GO:0048518	0.632	positive regulation of biological process
GO:0048585	0.630	negative regulation of response to stimulus
GO:0048522	0.569	positive regulation of cellular process
GO:0032502	0.490	developmental process
GO:0009968	0.419	negative regulation of signal transduction
GO:0042221	0.418	response to chemical
GO:0019222	0.374	regulation of metabolic process
GO:0032501	0.361	multicellular organismal process
GO:0080090	0.361	regulation of primary metabolic process
GO:0031323	0.361	regulation of cellular metabolic process
GO:0048856	0.358	anatomical structure development
GO:0042127	0.331	regulation of cell population proliferation
GO:0007275	0.300	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0005737	0.957	cytoplasm
GO:0005615	0.917	extracellular space
GO:0012505	0.911	endomembrane system
GO:0070013	0.808	intracellular organelle lumen
GO:0005788	0.540	endoplasmic reticulum lumen
GO:0031982	0.517	vesicle
GO:0071944	0.507	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]