StarFunc result for job id P22695

User Input

>input (453 residues)
MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSR
IGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMA
YTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAA
AYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNM
RGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVK
RGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKT
IAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVA
NADIINAAKKFVSGQKSMAASGNLGHTPFVDEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22695	1.000	1.000	1.694E-93	453	1.000	1.000	P22695.pdb.gz	QCR2_HUMAN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3
2	AFDB:Q9DB77	0.936	0.936	1.225E-81	453	0.857	0.857	Q9DB77.pdb.gz	QCR2_MOUSE Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc2 PE=1 SV=1
3	PDB:5xteK	0.910	0.983	1.988E-74	419	0.923	0.998	5xteK.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
4	PDB:7o37B	0.916	0.987	1.717E-70	420	0.797	0.860	7o37B.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
5	AFDB:O04308	0.885	0.806	1.282E-43	499	0.318	0.289	O04308.pdb.gz	MPPA2_ARATH Probable mitochondrial-processing peptidase subunit alpha-2, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPalpha2 PE=1 SV=1
6	AFDB:Q9VV75	0.868	0.893	1.694E-42	440	0.291	0.300	Q9VV75.pdb.gz	Q9VV75_DROME AT02348p OS=Drosophila melanogaster OX=7227 GN=UQCR-C2 PE=1 SV=1
7	AFDB:Q9ZU25	0.892	0.806	4.492E-42	503	0.327	0.294	Q9ZU25.pdb.gz	MPPA1_ARATH Probable mitochondrial-processing peptidase subunit alpha-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPalpha1 PE=1 SV=1
8	AFDB:P10507	0.870	0.854	3.268E-38	462	0.247	0.242	P10507.pdb.gz	MPPB_YEAST Mitochondrial-processing peptidase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAS1 PE=1 SV=1
9	AFDB:Q9VFF0	0.869	0.839	1.029E-37	470	0.234	0.226	Q9VFF0.pdb.gz	Q9VFF0_DROME GH01077p OS=Drosophila melanogaster OX=7227 GN=UQCR-C1 PE=1 SV=2
10	AFDB:Q42290	0.864	0.741	1.295E-37	531	0.252	0.215	Q42290.pdb.gz	MPPB_ARATH Probable mitochondrial-processing peptidase subunit beta, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPbeta PE=1 SV=2
11	AFDB:Q10713	0.855	0.743	1.452E-37	525	0.254	0.219	Q10713.pdb.gz	MPPA_HUMAN Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens OX=9606 GN=PMPCA PE=1 SV=2
12	PDB:1hr6D	0.870	0.889	5.559E-37	443	0.241	0.246	1hr6D.pdb.gz	Crystal structures of mitochondrial processing peptidase reveal the mode for specific cleavage of import signal sequences.
13	AFDB:Q23295	0.868	0.859	6.094E-37	458	0.232	0.229	Q23295.pdb.gz	MPPB_CAEEL Mitochondrial-processing peptidase subunit beta OS=Caenorhabditis elegans OX=6239 GN=mppb-1 PE=1 SV=2
14	PDB:1hr6A	0.852	0.845	1.212E-33	457	0.243	0.241	1hr6A.pdb.gz	Crystal structures of mitochondrial processing peptidase reveal the mode for specific cleavage of import signal sequences.
15	PDB:7o37A	0.860	0.873	5.704E-33	446	0.210	0.213	7o37A.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
16	PDB:5xteY	0.857	0.870	3.377E-32	446	0.196	0.200	5xteY.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
17	PDB:3hdiA	0.821	0.894	1.055E-30	414	0.179	0.196	3hdiA.pdb.gz	Crystal and solution structures of a prokaryotic M16B peptidase: an open and shut case.
18	PDB:1kb9A	0.814	0.854	1.184E-30	431	0.199	0.209	1kb9A.pdb.gz	SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
19	PDB:7rjaB	0.689	0.844	2.628E-22	364	0.203	0.253	7rjaB.pdb.gz	Rieske head domain dynamics and indazole-derivative inhibition of Candida albicans complex III.
20	PDB:6ofsA	0.719	0.384	2.608E-21	905	0.135	0.067	6ofsA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H3BRG4	0.0	774	412	0.828	0.910	H3BRG4_HUMAN Ubiquinol-cytochrome c reductase core protein 2 OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=1
2	P22695	0.0	932	453	1.000	1.000	QCR2_HUMAN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3
3	P32551	0.0	797	452	0.837	0.838	QCR2_RAT Cytochrome b-c1 complex subunit 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Uqcrc2 PE=1 SV=2
4	Q9DB77	0.0	813	453	0.857	0.857	QCR2_MOUSE Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc2 PE=1 SV=1
5	H3BP04	3.85e-122	355	176	0.389	1.000	H3BP04_HUMAN Ubiquinol-cytochrome c reductase core protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=1
6	Q9ZU25	1.42e-63	215	503	0.311	0.280	MPPA1_ARATH Probable mitochondrial-processing peptidase subunit alpha-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPalpha1 PE=1 SV=1
7	O04308	1.21e-60	207	499	0.309	0.281	MPPA2_ARATH Probable mitochondrial-processing peptidase subunit alpha-2, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPalpha2 PE=1 SV=1
8	Q9VV75	6.47e-58	199	440	0.298	0.307	Q9VV75_DROME AT02348p OS=Drosophila melanogaster OX=7227 GN=UQCR-C2 PE=1 SV=1
9	Q54F93	1.53e-39	149	445	0.265	0.270	MPPA2_DICDI Mitochondrial-processing peptidase subunit alpha-2 OS=Dictyostelium discoideum OX=44689 GN=mppA2 PE=1 SV=1
10	Q42290	4.69e-38	147	531	0.254	0.217	MPPB_ARATH Probable mitochondrial-processing peptidase subunit beta, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPbeta PE=1 SV=2
11	A0A1D8PCY8	7.21e-36	140	467	0.280	0.272	A0A1D8PCY8_CANAL Mas1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MAS1 PE=3 SV=1
12	P10507	1.78e-35	139	462	0.265	0.260	MPPB_YEAST Mitochondrial-processing peptidase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAS1 PE=1 SV=1
13	Q9DC61	2.75e-33	133	524	0.258	0.223	MPPA_MOUSE Mitochondrial-processing peptidase subunit alpha OS=Mus musculus OX=10090 GN=Pmpca PE=1 SV=1
14	Q5BFD3	3.73e-33	132	479	0.278	0.263	Q5BFD3_EMENI Mitochondrial-processing peptidase subunit beta, mitochondrial [Precursor] (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00747 PE=3 SV=1
15	Q10713	8.29e-33	132	525	0.258	0.223	MPPA_HUMAN Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens OX=9606 GN=PMPCA PE=1 SV=2
16	Q9VFF0	1.44e-32	130	470	0.249	0.240	Q9VFF0_DROME GH01077p OS=Drosophila melanogaster OX=7227 GN=UQCR-C1 PE=1 SV=2
17	Q9CXT8	5.39e-32	129	489	0.265	0.245	MPPB_MOUSE Mitochondrial-processing peptidase subunit beta OS=Mus musculus OX=10090 GN=Pmpcb PE=1 SV=1
18	Q23295	5.99e-32	129	458	0.256	0.253	MPPB_CAEEL Mitochondrial-processing peptidase subunit beta OS=Caenorhabditis elegans OX=6239 GN=mppb-1 PE=1 SV=2
19	P20069	1.29e-31	129	524	0.265	0.229	MPPA_RAT Mitochondrial-processing peptidase subunit alpha OS=Rattus norvegicus OX=10116 GN=Pmpca PE=1 SV=1
20	C8V3P5	2.31e-31	127	459	0.269	0.266	C8V3P5_EMENI Ubiquinol-cytochrome c reductase complex core protein 2 (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08273 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00675 Peptidase_M16	1.7e-29	114.2	Insulinase (Peptidase family M16)
2	PF05193 Peptidase_M16_C	1.2e-16	72.8	Peptidase M16 inactive domain
3	PF07338 YdgH_BhsA-like	43	15.5	YdgH/BhsA/McbA-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000203407	0.999	Cytochrome b-c1 complex subunit 1, mitochondrial
2	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
3	9606.ENSP00000306397	0.999	Cytochrome b-c1 complex subunit Rieske, mitochondrial
4	9606.ENSP00000309565	0.999	Cytochrome b-c1 complex subunit 6, mitochondrial
5	9606.ENSP00000317159	0.999	Cytochrome c1, heme protein, mitochondrial
6	9606.ENSP00000317780	0.999	Cytochrome c oxidase subunit 5A, mitochondrial
7	9606.ENSP00000332887	0.999	Cytochrome b-c1 complex subunit 9
8	9606.ENSP00000367939	0.999	Cytochrome b-c1 complex subunit 8
9	9606.ENSP00000392709	0.999	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
10	9606.ENSP00000430494	0.999	Cytochrome b-c1 complex subunit 7
11	9606.ENSP00000354876	0.998	Cytochrome c oxidase subunit 2
12	9606.ENSP00000252711	0.997	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
13	9606.ENSP00000258424	0.997	Cytochrome c oxidase subunit 5B, mitochondrial
14	9606.ENSP00000354499	0.997	Cytochrome c oxidase subunit 1
15	9606.ENSP00000356972	0.997	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
16	9606.ENSP00000364649	0.997	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
17	9606.ENSP00000457513	0.997	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
18	9606.ENSP00000296684	0.996	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
19	9606.ENSP00000354554	0.996	Cytochrome b
20	9606.ENSP00000307786	0.995	Cytochrome c

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.661	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0008152	0.996	metabolic process
GO:0006091	0.977	generation of precursor metabolites and energy
GO:0009060	0.955	aerobic respiration
GO:0006119	0.817	oxidative phosphorylation
GO:0071704	0.413	organic substance metabolic process
GO:0044238	0.411	primary metabolic process
GO:0006807	0.371	nitrogen compound metabolic process
GO:0071840	0.315	cellular component organization or biogenesis
GO:0016043	0.312	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098800	1.000	inner mitochondrial membrane protein complex
GO:1990204	0.999	oxidoreductase complex
GO:1902495	0.999	transmembrane transporter complex
GO:0098803	0.999	respiratory chain complex
GO:0005746	0.999	mitochondrial respirasome
GO:0070013	0.997	intracellular organelle lumen
GO:0070069	0.995	cytochrome complex
GO:0031981	0.990	nuclear lumen
GO:0045275	0.952	respiratory chain complex III
GO:0005750	0.921	mitochondrial respiratory chain complex III
GO:0005654	0.853	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]