StarFunc result for job id P22732

User Input

>input (501 residues)
MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGE
FMEDFPLTLLWSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSR
VATSFELIIISRLLVGICAGVSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIF
GLRNLLANVDGWPILLGLTGVPAALQLLLLPFFPESPRYLLIQKKDEAAAKKALQTLRGW
DSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLSIIVLMGGQQLSGVNAIYYYA
DQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFSICLIACCVLT
AALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHW
LSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNK
VSEVYPEKEELKELPPVTSEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22732	1.000	1.000	1.921E-64	501	1.000	1.000	P22732.pdb.gz	GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens OX=9606 GN=SLC2A5 PE=1 SV=1
2	AFDB:Q9WV38	0.959	0.959	1.026E-55	501	0.828	0.828	Q9WV38.pdb.gz	GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus OX=10090 GN=Slc2a5 PE=1 SV=2
3	AFDB:P43427	0.987	0.985	1.533E-55	502	0.818	0.817	P43427.pdb.gz	GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus OX=10116 GN=Slc2a5 PE=1 SV=1
4	AFDB:Q6PXP3	0.944	0.924	1.828E-46	512	0.587	0.574	Q6PXP3.pdb.gz	GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens OX=9606 GN=SLC2A7 PE=1 SV=2
5	PDB:4ybqB	0.875	0.948	7.904E-44	462	0.756	0.820	4ybqB.pdb.gz
6	AFDB:Q285P3	0.926	0.951	5.494E-37	488	0.403	0.414	Q285P3.pdb.gz	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
7	AFDB:P11166	0.928	0.944	6.452E-37	492	0.403	0.411	P11166.pdb.gz	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
8	AFDB:F1R0Q1	0.919	0.941	1.562E-36	489	0.399	0.409	F1R0Q1.pdb.gz	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
9	AFDB:Q3T9X0	0.844	0.790	4.813E-36	538	0.435	0.405	Q3T9X0.pdb.gz	GTR9_MOUSE Solute carrier family 2, facilitated glucose transporter member 9 OS=Mus musculus OX=10090 GN=Slc2a9 PE=1 SV=1
10	AFDB:P46896	0.925	0.946	6.911E-36	490	0.407	0.416	P46896.pdb.gz	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
11	AFDB:Q9NRM0	0.834	0.778	2.308E-35	540	0.435	0.404	Q9NRM0.pdb.gz	GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens OX=9606 GN=SLC2A9 PE=1 SV=2
12	PDB:7sptA	0.917	0.977	9.979E-33	470	0.375	0.400	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
13	PDB:6thaA	0.792	0.878	5.714E-30	448	0.387	0.433	6thaA.pdb.gz
14	PDB:7wsmA	0.809	0.868	2.152E-29	464	0.403	0.435	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
15	PDB:7aaqA	0.830	0.852	2.051E-18	487	0.244	0.251	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
16	PDB:4gbyA	0.802	0.844	6.319E-18	475	0.232	0.244	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
17	PDB:4ja4A	0.664	0.741	7.675E-14	442	0.226	0.256	4ja4A.pdb.gz
18	PDB:7zh0A	0.670	0.678	2.082E-9	495	0.190	0.192	7zh0A.pdb.gz
19	PDB:7bc7A	0.574	0.652	6.021E-7	432	0.124	0.144	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
20	PDB:6s4mA	0.561	0.648	6.525E-7	426	0.132	0.155	6s4mA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P22732	0.0	1007	501	1.000	1.000	GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens OX=9606 GN=SLC2A5 PE=1 SV=1
2	P43427	0.0	826	502	0.818	0.817	GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus OX=10116 GN=Slc2a5 PE=1 SV=1
3	Q6PXP3	0.0	573	512	0.587	0.574	GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens OX=9606 GN=SLC2A7 PE=1 SV=2
4	Q9WV38	0.0	806	501	0.828	0.828	GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus OX=10090 GN=Slc2a5 PE=1 SV=2
5	Q3T9X0	9.08e-150	440	538	0.439	0.409	GTR9_MOUSE Solute carrier family 2, facilitated glucose transporter member 9 OS=Mus musculus OX=10090 GN=Slc2a9 PE=1 SV=1
6	Q9NRM0	8.93e-147	433	540	0.435	0.404	GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens OX=9606 GN=SLC2A9 PE=1 SV=2
7	Q285P3	1.95e-135	402	488	0.405	0.416	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
8	P17809	5.91e-133	396	492	0.421	0.429	GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus OX=10090 GN=Slc2a1 PE=1 SV=4
9	P11167	9.95e-133	395	492	0.415	0.423	GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus OX=10116 GN=Slc2a1 PE=1 SV=1
10	P27674	7.88e-132	393	492	0.417	0.425	GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus OX=9913 GN=SLC2A1 PE=1 SV=1
11	F1R0Q1	3.60e-131	391	489	0.407	0.417	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
12	P11166	5.03e-131	391	492	0.413	0.421	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
13	A0A060VUB5	8.80e-131	390	480	0.407	0.425	A0A060VUB5_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00081471001 PE=3 SV=1
14	Q9I8M1	4.06e-128	384	492	0.411	0.419	Q9I8M1_ONCMY Glucose transporter 1A OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
15	P46896	2.68e-127	381	490	0.413	0.422	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
16	Q9BYW1	1.91e-126	379	496	0.403	0.407	GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens OX=9606 GN=SLC2A11 PE=2 SV=1
17	F1NTJ1	1.92e-123	372	496	0.399	0.403	F1NTJ1_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A14 PE=3 SV=2
18	P28568	1.52e-122	369	496	0.397	0.401	GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A3 PE=2 SV=1
19	P32037	3.40e-119	360	493	0.419	0.426	GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus OX=10090 GN=Slc2a3 PE=1 SV=1
20	A0A060WJ53	3.43e-119	360	477	0.385	0.405	A0A060WJ53_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006116001 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	2.4e-16	71.2	Major Facilitator Superfamily
2	PF00083 Sugar_tr	5.1e-136	465.8	Sugar (and other) transporter
3	PF00335 Tetraspanin	7.9e+02	11.1	Tetraspanin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366641

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266088	0.875	Sodium/glucose cotransporter 1
2	9606.ENSP00000366654	0.840	Carbonic anhydrase 6
3	9606.ENSP00000260599	0.772	Ketohexokinase
4	9606.ENSP00000285381	0.764	Carbonic anhydrase 3
5	9606.ENSP00000366628	0.736	G-protein coupled receptor 157
6	9606.ENSP00000364520	0.725	Taste receptor type 1 member 2
7	9606.ENSP00000344411	0.722	Taste receptor type 1 member 3
8	9606.ENSP00000264029	0.719	Trehalase
9	9606.ENSP00000462521	0.698	Thioredoxin-interacting protein
10	9606.ENSP00000238667	0.686	Feline leukemia virus subgroup C receptor-related protein 2
11	9606.ENSP00000328551	0.681	Ras-related protein Rab-28
12	9606.ENSP00000219150	0.667	Coronin-1A
13	9606.ENSP00000234590	0.666	Alpha-enolase
14	9606.ENSP00000304783	0.647	Prestin
15	9606.ENSP00000365686	0.647	Solute carrier family 15 member 1
16	9606.ENSP00000258534	0.642	DNA damage-regulated autophagy modulator protein 1
17	9606.ENSP00000337224	0.626	Lecithin retinol acyltransferase
18	9606.ENSP00000216122	0.624	DNA replication licensing factor MCM5
19	9606.ENSP00000236495	0.610	Sodium/glucose cotransporter 4
20	9606.ENSP00000285379	0.610	Carbonic anhydrase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005355	1.000	glucose transmembrane transporter activity
GO:0005353	0.999	fructose transmembrane transporter activity
GO:0005488	0.980	binding
GO:0005515	0.853	protein binding
GO:0015291	0.560	secondary active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034219	0.997	carbohydrate transmembrane transport
GO:0008645	0.994	hexose transmembrane transport
GO:1904659	0.729	glucose transmembrane transport
GO:0050896	0.458	response to stimulus
GO:0008152	0.412	metabolic process
GO:0032501	0.401	multicellular organismal process
GO:0071704	0.375	organic substance metabolic process
GO:0065007	0.346	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.798	organelle
GO:0043227	0.792	membrane-bounded organelle
GO:0005622	0.656	intracellular anatomical structure
GO:0005737	0.577	cytoplasm
GO:0043229	0.396	intracellular organelle
GO:0043231	0.327	intracellular membrane-bounded organelle
GO:0012505	0.322	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]