StarFunc result for job id P22736

User Input

>input (598 residues)
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGY
TGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPV
DEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKA
SGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHL
EGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
YICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDAS
PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKW
AEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFG
DWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVA
AVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1D8N6	0.393	0.393	9.004E-44	598	0.545	0.545	F1D8N6.pdb.gz	F1D8N6_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
2	AFDB:F1RER4	0.542	0.511	2.518E-42	635	0.508	0.479	F1RER4.pdb.gz
3	AFDB:P51179	0.538	0.513	3.207E-38	628	0.508	0.484	P51179.pdb.gz	NR4A3_RAT Nuclear receptor subfamily 4 group A member 3 OS=Rattus norvegicus OX=10116 GN=Nr4a3 PE=1 SV=1
4	AFDB:F8W6I3	0.295	0.317	3.592E-22	553	0.396	0.429	F8W6I3.pdb.gz	F8W6I3_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
5	AFDB:B3DGQ7	0.272	0.363	4.786E-18	428	0.202	0.283	B3DGQ7.pdb.gz
6	PDB:3dzyA	0.410	0.744	3.022E-17	302	0.182	0.361	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
7	AFDB:Q9GLW0	0.339	0.222	5.651E-16	939	0.246	0.157	Q9GLW0.pdb.gz	PRGR_CANLF Progesterone receptor OS=Canis lupus familiaris OX=9615 GN=PGR PE=2 SV=1
8	AFDB:D0EWS6	0.329	0.217	1.102E-14	934	0.244	0.156	D0EWS6.pdb.gz	D0EWS6_PIG Progesterone receptor OS=Sus scrofa OX=9823 GN=PGR PE=2 SV=1
9	PDB:6fx0A	0.366	0.880	1.791E-13	238	0.125	0.315	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
10	PDB:1g2nA	0.294	0.673	3.374E-7	246	0.099	0.240	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
11	PDB:7kw7F	0.312	0.684	6.627E-7	259	0.079	0.181	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
12	AFDB:E7EY47	0.084	0.061	3.739E-2	958	0.135	0.085	E7EY47.pdb.gz	E7EY47_DANRE Rho guanine nucleotide exchange factor (GEF) 19 OS=Danio rerio OX=7955 GN=arhgef19 PE=4 SV=1
13	AFDB:A0A024QZV9	0.078	0.063	5.865E-2	834	0.135	0.097	A0A024QZV9.pdb.gz
14	AFDB:A0A0B4K621	0.089	0.070	5.865E-2	860	0.189	0.131	A0A0B4K621.pdb.gz	A0A0B4K621_DROME Rfx, isoform G OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
15	PDB:7vciR	0.097	0.074	2.063E-1	1082	0.075	0.042	7vciR.pdb.gz
16	PDB:7qskH	0.092	0.143	4.637E-1	318	0.065	0.123	7qskH.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
17	PDB:7qsnH	0.125	0.210	5.808E-1	291	0.064	0.131	7qsnH.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
18	PDB:1qoyA	0.067	0.111	6.075E-1	303	0.050	0.099	1qoyA.pdb.gz
19	PDB:4alyA	0.067	0.133	6.355E-1	211	0.052	0.147	4alyA.pdb.gz
20	PDB:5nx7A	0.080	0.134	6.355E-1	308	0.043	0.084	5nx7A.pdb.gz	Structural Basis of Catalysis in the Bacterial Monoterpene Synthases Linalool Synthase and 1,8-Cineole Synthase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R9YJF7	0.0	568	598	0.540	0.540	A0A2R9YJF7_DANRE Nuclear receptor subfamily 4 group A member 2 OS=Danio rerio OX=7955 GN=nr4a2a PE=3 SV=1
2	A9Q8C8	0.0	568	598	0.540	0.540	A9Q8C8_DANRE Nuclear receptor subfamily 4 group A member 2 OS=Danio rerio OX=7955 GN=nr4a2a PE=2 SV=1
3	F1D8N6	0.0	583	598	0.562	0.562	F1D8N6_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
4	F5GXF0	0.0	1206	652	1.000	0.917	F5GXF0_HUMAN Nuclear receptor subfamily 4 group A member 1 OS=Homo sapiens OX=9606 GN=NR4A1 PE=1 SV=1
5	H3BT85	0.0	572	302	0.483	0.957	H3BT85_HUMAN Nuclear receptor subfamily 4 group A member 1 (Fragment) OS=Homo sapiens OX=9606 GN=NR4A1 PE=1 SV=1
6	P12813	0.0	1004	601	0.908	0.903	NR4A1_MOUSE Nuclear receptor subfamily 4 group A member 1 OS=Mus musculus OX=10090 GN=Nr4a1 PE=1 SV=1
7	P22736	0.0	1207	598	1.000	1.000	NR4A1_HUMAN Nuclear receptor subfamily 4immunitygroup A member 1 OS=Homo sapiens OX=9606 GN=NR4A1 PE=1 SV=1
8	P22829	0.0	997	597	0.905	0.906	NR4A1_RAT Nuclear receptor subfamily 4 group A member 1 OS=Rattus norvegicus OX=10116 GN=Nr4a1 PE=1 SV=2
9	P43354	0.0	583	598	0.562	0.562	NR4A2_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
10	Q06219	0.0	583	598	0.567	0.567	NR4A2_MOUSE Nuclear receptor subfamily 4 group A member 2 OS=Mus musculus OX=10090 GN=Nr4a2 PE=1 SV=1
11	Q07917	0.0	580	598	0.564	0.564	NR4A2_RAT Nuclear receptor subfamily 4 group A member 2 OS=Rattus norvegicus OX=10116 GN=Nr4a2 PE=1 SV=3
12	Q6DH08	0.0	561	586	0.537	0.548	Q6DH08_DANRE Nuclear receptor subfamily 4 group A member 2 OS=Danio rerio OX=7955 GN=nurr1 PE=2 SV=1
13	Q92570	3.55e-166	489	626	0.512	0.489	NR4A3_HUMAN Nuclear receptor subfamily 4 group A member 3 OS=Homo sapiens OX=9606 GN=NR4A3 PE=1 SV=3
14	Q9QZB6	6.69e-160	473	627	0.512	0.488	NR4A3_MOUSE Nuclear receptor subfamily 4 group A member 3 OS=Mus musculus OX=10090 GN=Nr4a3 PE=1 SV=1
15	P51179	6.83e-160	473	628	0.513	0.489	NR4A3_RAT Nuclear receptor subfamily 4 group A member 3 OS=Rattus norvegicus OX=10116 GN=Nr4a3 PE=1 SV=1
16	P49869	1.87e-146	452	1073	0.360	0.200	HR38_DROME Probable nuclear hormone receptor HR38 OS=Drosophila melanogaster OX=7227 GN=Hr38 PE=1 SV=3
17	F8W6I3	1.43e-120	370	553	0.411	0.445	F8W6I3_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
18	H3BPN8	2.74e-96	292	150	0.251	1.000	H3BPN8_HUMAN Nuclear receptor subfamily 4 group A member 1 (Fragment) OS=Homo sapiens OX=9606 GN=NR4A1 PE=1 SV=1
19	P22448	1.41e-59	207	455	0.199	0.262	RARB_CHICK Retinoic acid receptor beta OS=Gallus gallus OX=9031 GN=RARB PE=2 SV=2
20	E7BBH7	1.59e-59	208	502	0.209	0.249	E7BBH7_ONCMY Retinoic acid receptor, gamma, variant a OS=Oncorhynchus mykiss OX=8022 GN=rarg a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	1.7e-28	111.3	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	2e-27	106.7	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000440864

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263253	0.997	Histone acetyltransferase p300
2	9606.ENSP00000381185	0.980	Apoptosis regulator Bcl-2
3	9606.ENSP00000419692	0.976	Retinoic acid receptor RXR-alpha
4	9606.ENSP00000451828	0.957	RAC-alpha serine/threonine-protein kinase
5	9606.ENSP00000271555	0.948	Myocyte-specific enhancer factor 2D
6	9606.ENSP00000352900	0.940	Retinoic acid receptor RXR-gamma
7	9606.ENSP00000375892	0.936	RAC-beta serine/threonine-protein kinase
8	9606.ENSP00000324856	0.929	Serine/threonine-protein kinase STK11
9	9606.ENSP00000363817	0.925	Retinoic acid receptor RXR-beta
10	9606.ENSP00000389377	0.919	Nuclear factor of activated T-cells, cytoplasmic 1
11	9606.ENSP00000269305	0.910	Cellular tumor antigen p53
12	9606.ENSP00000263826	0.901	RAC-gamma serine/threonine-protein kinase
13	9606.ENSP00000215832	0.881	Mitogen-activated protein kinase 1
14	9606.ENSP00000263025	0.877	Mitogen-activated protein kinase 3
15	9606.ENSP00000245919	0.869	Protein fosB
16	9606.ENSP00000317128	0.869	Plexin-D1
17	9606.ENSP00000311005	0.867	Mitogen-activated protein kinase 7
18	9606.ENSP00000262241	0.844	REST corepressor 1
19	9606.ENSP00000306245	0.835	Proto-oncogene c-Fos
20	9606.ENSP00000239938	0.828	Early growth response protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0060089	0.998	molecular transducer activity
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0042802	0.931	identical protein binding
GO:0008134	0.925	transcription factor binding
GO:0098531	0.875	ligand-activated transcription factor activity
GO:0038023	0.864	signaling receptor activity
GO:0001067	0.852	transcription regulatory region nucleic acid binding
GO:0000976	0.837	transcription cis-regulatory region binding
GO:0140297	0.761	DNA-binding transcription factor binding
GO:0004879	0.668	nuclear receptor activity
GO:0061629	0.665	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0046983	0.578	protein dimerization activity
GO:0000977	0.558	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0016922	0.531	nuclear receptor binding
GO:0019899	0.440	enzyme binding
GO:0035259	0.414	nuclear glucocorticoid receptor binding
GO:0000987	0.395	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.366	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.998	regulation of primary metabolic process
GO:0051171	0.998	regulation of nitrogen compound metabolic process
GO:0009987	0.989	cellular process
GO:0010604	0.989	positive regulation of macromolecule metabolic process
GO:0050896	0.988	response to stimulus
GO:0048522	0.987	positive regulation of cellular process
GO:0006355	0.987	regulation of DNA-templated transcription
GO:0051173	0.986	positive regulation of nitrogen compound metabolic process
GO:0031325	0.983	positive regulation of cellular metabolic process
GO:0006357	0.978	regulation of transcription by RNA polymerase II
GO:1902680	0.968	positive regulation of RNA biosynthetic process
GO:0045893	0.964	positive regulation of DNA-templated transcription
GO:0045944	0.951	positive regulation of transcription by RNA polymerase II
GO:0032502	0.736	developmental process
GO:0048856	0.671	anatomical structure development
GO:0051716	0.642	cellular response to stimulus
GO:0032501	0.641	multicellular organismal process
GO:0042221	0.618	response to chemical
GO:0048519	0.572	negative regulation of biological process
GO:0048523	0.499	negative regulation of cellular process
GO:0007154	0.453	cell communication
GO:0023052	0.442	signaling
GO:0008152	0.383	metabolic process
GO:0007275	0.365	multicellular organism development
GO:0007165	0.359	signal transduction
GO:0009892	0.357	negative regulation of metabolic process
GO:0071704	0.343	organic substance metabolic process
GO:0010033	0.330	response to organic substance
GO:0010605	0.326	negative regulation of macromolecule metabolic process
GO:0051172	0.313	negative regulation of nitrogen compound metabolic process
GO:0031324	0.312	negative regulation of cellular metabolic process
GO:0044238	0.305	primary metabolic process
GO:0070887	0.301	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.997	cytoplasm
GO:0005829	0.991	cytosol
GO:0012505	0.985	endomembrane system
GO:0016020	0.984	membrane
GO:0031090	0.862	organelle membrane
GO:0031975	0.805	envelope
GO:0005635	0.780	nuclear envelope
GO:0031965	0.754	nuclear membrane
GO:0032991	0.713	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]