StarFunc result for job id P22749

User Input

>input (145 residues)
MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQ
ELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQ
GLVAGETAQQICEDLRLCIPSTGPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22749	1.000	1.000	1.619E-21	145	1.000	1.000	P22749.pdb.gz	GNLY_HUMAN Granulysin OS=Homo sapiens OX=9606 GN=GNLY PE=1 SV=3
2	AFDB:Q24JZ1	0.533	0.530	2.573E-7	146	0.345	0.342	Q24JZ1.pdb.gz	Q24JZ1_BOVIN Granulysin OS=Bos taurus OX=9913 GN=GNLY PE=1 SV=1
3	AFDB:Q9Y125	0.465	0.080	1.643E-2	953	0.200	0.030	Q9Y125.pdb.gz	Q9Y125_DROME BcDNA.GH08312 OS=Drosophila melanogaster OX=7227 GN=Sap-r PE=1 SV=1
4	AFDB:Q22291	0.416	0.529	5.190E-2	108	0.103	0.139	Q22291.pdb.gz	Q22291_CAEEL Saposin B-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=spp-1 PE=1 SV=2
5	AFDB:Q54Q68	0.363	0.129	6.825E-2	522	0.145	0.040	Q54Q68.pdb.gz	Q54Q68_DICDI Saposin A OS=Dictyostelium discoideum OX=44689 GN=sapA PE=4 SV=1
6	AFDB:Q9XVI5	0.415	0.531	9.481E-2	106	0.090	0.123	Q9XVI5.pdb.gz	Q9XVI5_CAEEL Saposin B-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=spp-12 PE=1 SV=1
7	AFDB:F1SU97	0.304	0.109	1.552E-1	492	0.172	0.051	F1SU97.pdb.gz	F1SU97_PIG Prosaposin OS=Sus scrofa OX=9823 GN=PSAP PE=1 SV=2
8	PDB:5w7dA	0.424	0.128	1.810E-1	528	0.097	0.027	5w7dA.pdb.gz	Crystal structure of the mammalian lipopolysaccharide detoxifier.
9	AFDB:A0A024QZQ2	0.314	0.103	1.932E-1	524	0.159	0.044	A0A024QZQ2.pdb.gz
10	AFDB:Q5RK17	0.187	0.129	2.684E-1	237	0.131	0.080	Q5RK17.pdb.gz	Q5RK17_RAT Direct IAP-binding protein with low pI OS=Rattus norvegicus OX=10116 GN=Diablo PE=1 SV=1
11	AFDB:A0A0S2Z5U7	0.183	0.121	3.164E-1	239	0.145	0.088	A0A0S2Z5U7.pdb.gz	A0A0S2Z5U7_HUMAN Direct IAP-binding protein with low pI (Fragment) OS=Homo sapiens OX=9606 GN=DIABLO PE=2 SV=1
12	PDB:7nvoE	0.278	0.181	1.451	249	0.097	0.056	7nvoE.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
13	PDB:1wa5B	0.189	0.076	3.123	466	0.166	0.052	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
14	PDB:3iqcA	0.227	0.268	3.123	119	0.103	0.126	3iqcA.pdb.gz
15	PDB:6hivDH	0.214	0.085	3.299	564	0.110	0.028	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
16	PDB:4pacA	0.221	0.212	4.107	153	0.103	0.098	4pacA.pdb.gz
17	PDB:7dgqg	0.165	0.146	4.338	173	0.124	0.104	7dgqg.pdb.gz	A Dynamic Substrate Pool Revealed by cryo-EM of a Lipid-Preserved Respiratory Supercomplex.
18	PDB:2ja2A	0.203	0.070	5.113	485	0.062	0.019	2ja2A.pdb.gz
19	PDB:7acjy	0.177	0.263	5.113	86	0.048	0.081	7acjy.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
20	PDB:7nsba	0.179	0.057	5.113	568	0.062	0.016	7nsba.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P22749	2.60e-105	298	145	1.000	1.000	GNLY_HUMAN Granulysin OS=Homo sapiens OX=9606 GN=GNLY PE=1 SV=3
2	Q24JZ1	2.46e-31	111	146	0.386	0.384	Q24JZ1_BOVIN Granulysin OS=Bos taurus OX=9913 GN=GNLY PE=1 SV=1
3	Q6NUJ1	0.059	35.0	521	0.145	0.040	SAPL1_HUMAN Proactivator polypeptide-like 1 OS=Homo sapiens OX=9606 GN=PSAPL1 PE=2 SV=2
4	Q583M5	0.14	34.3	1621	0.138	0.012	Q583M5_TRYB2 TOG domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.840 PE=3 SV=1
5	F1SU97	0.39	32.7	492	0.110	0.033	F1SU97_PIG Prosaposin OS=Sus scrofa OX=9823 GN=PSAP PE=1 SV=2
6	Q9U9P3	0.87	31.6	441	0.117	0.039	Q9U9P3_DROME Ecdysone dependent glycoprotein (Fragment) OS=Drosophila melanogaster OX=7227 GN=Sap-r PE=2 SV=1
7	Q8IMH4	1.2	31.6	876	0.117	0.019	Q8IMH4_DROME Saposin-related, isoform B OS=Drosophila melanogaster OX=7227 GN=Sap-r PE=1 SV=2
8	Q9Y125	1.3	31.2	953	0.117	0.018	Q9Y125_DROME BcDNA.GH08312 OS=Drosophila melanogaster OX=7227 GN=Sap-r PE=1 SV=1
9	Q19319	1.8	30.8	4328	0.214	0.007	CADH4_CAEEL Cadherin-4 OS=Caenorhabditis elegans OX=6239 GN=cdh-4 PE=1 SV=4
10	Q581C5	2.9	30.0	750	0.145	0.028	Q581C5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10J17.130 PE=4 SV=1
11	Q389P5	3.5	30.0	903	0.090	0.014	Q389P5_TRYB2 Argonaute-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0020 PE=4 SV=1
12	Q9NPY3	7.0	28.9	652	0.124	0.028	C1QR1_HUMAN Complement component C1q receptor OS=Homo sapiens OX=9606 GN=CD93 PE=1 SV=3
13	P0C6X5	8.8	28.9	6729	0.110	0.002	R1AB_CVHNL Replicase polyprotein 1ab OS=Human coronavirus NL63 OX=277944 GN=rep PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03489 SapB_2	0.084	24.4	Saposin-like type B, region 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263863

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277541	0.987	Neurogenic locus notch homolog protein 1
2	9606.ENSP00000398568	0.987	Perforin-1
3	9606.ENSP00000216341	0.943	Granzyme B
4	9606.ENSP00000274306	0.927	Granzyme A
5	9606.ENSP00000216338	0.912	Granzyme H
6	9606.ENSP00000221978	0.899	Protein NKG7
7	9606.ENSP00000452780	0.849	Beta-2-microglobulin
8	9606.ENSP00000480421	0.839	Serrate RNA effector molecule homolog
9	9606.ENSP00000375629	0.828	Leukocyte immunoglobulin-like receptor subfamily B member 2
10	9606.ENSP00000371333	0.770	Natural killer cells antigen CD94
11	9606.ENSP00000386559	0.769	T-cell surface glycoprotein CD8 alpha chain
12	9606.ENSP00000203629	0.682	Lymphocyte activation gene 3 protein
13	9606.ENSP00000356540	0.664	Syntaxin-11
14	9606.ENSP00000358490	0.654	T-cell surface antigen CD2
15	9606.ENSP00000207549	0.653	Protein unc-13 homolog D
16	9606.ENSP00000231009	0.650	Granzyme K
17	9606.ENSP00000011653	0.625	T-cell surface glycoprotein CD4
18	9606.ENSP00000356694	0.619	Tumor necrosis factor ligand superfamily member 6
19	9606.ENSP00000229402	0.616	Killer cell lectin-like receptor subfamily B member 1
20	9606.ENSP00000177694	0.615	T-box transcription factor TBX21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0001906	0.992	cell killing
GO:0061844	0.985	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0031640	0.951	killing of cells of another organism
GO:0006968	0.929	cellular defense response
GO:0009617	0.849	response to bacterium
GO:0042742	0.710	defense response to bacterium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.999	intracellular organelle lumen
GO:0005615	0.996	extracellular space
GO:0031410	0.996	cytoplasmic vesicle
GO:0030139	0.994	endocytic vesicle
GO:0005764	0.990	lysosome
GO:0045335	0.979	phagocytic vesicle
GO:0071682	0.974	endocytic vesicle lumen
GO:0005886	0.939	plasma membrane
GO:0044194	0.734	cytolytic granule
GO:0097013	0.725	phagocytic vesicle lumen
GO:0012505	0.511	endomembrane system
GO:0005634	0.386	nucleus
GO:0005654	0.310	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]