StarFunc result for job id P23025

User Input

>input (273 residues)
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMA
NVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI
VHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23025	1.000	1.000	2.540E-48	273	1.000	1.000	P23025.pdb.gz	XPA_HUMAN DNA repair protein complementing XP-A cells OS=Homo sapiens OX=9606 GN=XPA PE=1 SV=1
2	AFDB:Q64267	0.633	0.635	1.992E-41	272	0.842	0.846	Q64267.pdb.gz	XPA_MOUSE DNA repair protein complementing XP-A cells homolog OS=Mus musculus OX=10090 GN=Xpa PE=1 SV=2
3	AFDB:P27088	0.580	0.592	3.636E-36	267	0.685	0.700	P27088.pdb.gz	XPA_XENLA DNA repair protein complementing XP-A cells homolog OS=Xenopus laevis OX=8355 GN=xpa PE=2 SV=1
4	AFDB:P27089	0.589	0.601	8.814E-34	267	0.663	0.678	P27089.pdb.gz	XPA_CHICK DNA repair protein complementing XP-A cells homolog OS=Gallus gallus OX=9031 GN=XPA PE=2 SV=1
5	AFDB:D4A981	0.507	0.572	6.316E-33	241	0.703	0.797	D4A981.pdb.gz	D4A981_RAT XPA, DNA damage recognition and repair factor OS=Rattus norvegicus OX=10116 GN=Xpa PE=3 SV=1
6	AFDB:P28518	0.573	0.532	3.549E-25	296	0.462	0.426	P28518.pdb.gz	XPA_DROME DNA repair protein complementing XP-A cells homolog OS=Drosophila melanogaster OX=7227 GN=Xpac PE=2 SV=3
7	AFDB:Q21302	0.479	0.539	2.810E-20	241	0.293	0.332	Q21302.pdb.gz	Q21302_CAEEL XPA C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=xpa-1 PE=1 SV=1
8	PDB:7ad8G	0.435	0.844	4.613E-19	134	0.491	1.000	7ad8G.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
9	AFDB:O59753	0.484	0.460	6.678E-14	289	0.293	0.277	O59753.pdb.gz	RAD14_SCHPO DNA repair protein rad14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp14 PE=1 SV=1
10	AFDB:P28519	0.456	0.347	3.641E-12	371	0.260	0.191	P28519.pdb.gz	RAD14_YEAST DNA repair protein RAD14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD14 PE=1 SV=2
11	PDB:5lclB	0.341	0.748	1.886E-7	114	0.128	0.307	5lclB.pdb.gz	Structural Insights into the Recognition of N(2) -Aryl- and C8-Aryl DNA Lesions by the Repair Protein XPA/Rad14.
12	AFDB:Q6PML9	0.291	0.148	2.784E-6	568	0.154	0.074	Q6PML9.pdb.gz	ZNT9_HUMAN Proton-coupled zinc antiporter SLC30A9, mitochondrial OS=Homo sapiens OX=9606 GN=SLC30A9 PE=1 SV=1
13	PDB:7abi7	0.087	0.100	1.725E-1	236	0.070	0.081	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
14	PDB:6hlqI	0.084	0.169	4.222E-1	111	0.044	0.108	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
15	PDB:4c2mI	0.083	0.159	6.039E-1	124	0.029	0.065	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
16	PDB:4v6wCo	0.068	0.172	1.312	104	0.026	0.067	4v6wCo.pdb.gz	Structures of the human and Drosophila 80S ribosome.
17	PDB:4a6uA	0.081	0.063	1.569	389	0.037	0.026	4a6uA.pdb.gz
18	PDB:6zyeA	0.129	0.149	1.666	222	0.051	0.063	6zyeA.pdb.gz
19	PDB:7nacn	0.153	0.109	1.666	425	0.051	0.033	7nacn.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
20	PDB:4v6wAX	0.069	0.122	1.768	143	0.048	0.091	4v6wAX.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23025	0.0	566	273	1.000	1.000	XPA_HUMAN DNA repair protein complementing XP-A cells OS=Homo sapiens OX=9606 GN=XPA PE=1 SV=1
2	A0A8I6G6T5	3.37e-155	435	273	0.850	0.850	A0A8I6G6T5_RAT XPA, DNA damage recognition and repair factor OS=Rattus norvegicus OX=10116 GN=Xpa PE=3 SV=1
3	Q64267	1.42e-152	428	272	0.832	0.835	XPA_MOUSE DNA repair protein complementing XP-A cells homolog OS=Mus musculus OX=10090 GN=Xpa PE=1 SV=2
4	P27088	2.06e-125	359	267	0.685	0.700	XPA_XENLA DNA repair protein complementing XP-A cells homolog OS=Xenopus laevis OX=8355 GN=xpa PE=2 SV=1
5	P27089	6.49e-120	345	267	0.656	0.670	XPA_CHICK DNA repair protein complementing XP-A cells homolog OS=Gallus gallus OX=9031 GN=XPA PE=2 SV=1
6	D4A981	3.71e-119	342	241	0.645	0.730	D4A981_RAT XPA, DNA damage recognition and repair factor OS=Rattus norvegicus OX=10116 GN=Xpa PE=3 SV=1
7	P28518	5.85e-73	227	296	0.462	0.426	XPA_DROME DNA repair protein complementing XP-A cells homolog OS=Drosophila melanogaster OX=7227 GN=Xpac PE=2 SV=3
8	Q21302	1.37e-48	163	241	0.330	0.373	Q21302_CAEEL XPA C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=xpa-1 PE=1 SV=1
9	O59753	5.01e-17	80.9	289	0.253	0.239	RAD14_SCHPO DNA repair protein rad14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp14 PE=1 SV=1
10	P28519	2.29e-11	65.5	371	0.198	0.146	RAD14_YEAST DNA repair protein RAD14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD14 PE=1 SV=2
11	Q6PML9	8.64e-06	48.9	568	0.117	0.056	ZNT9_HUMAN Proton-coupled zinc antiporter SLC30A9, mitochondrial OS=Homo sapiens OX=9606 GN=SLC30A9 PE=1 SV=1
12	Q5IRJ6	3.55e-05	47.0	567	0.103	0.049	ZNT9_MOUSE Proton-coupled zinc antiporter SLC30A9, mitochondrial OS=Mus musculus OX=10090 GN=Slc30a9 PE=1 SV=2
13	Q9VHM6	0.19	35.4	312	0.084	0.074	OUIB_DROME Transcription factor Ouib OS=Drosophila melanogaster OX=7227 GN=Ouib PE=2 SV=2
14	P29152	0.51	34.3	3206	0.073	0.006	POLG_PSBMV Genome polyprotein OS=Pea seed-borne mosaic virus (strain DPD1) OX=31736 PE=1 SV=1
15	Q949S9	1.3	32.3	253	0.095	0.103	SPF27_ARATH Pre-mRNA-splicing factor SPF27 homolog OS=Arabidopsis thaliana OX=3702 GN=MOS4 PE=1 SV=1
16	Q9VMP3	2.6	32.0	913	0.066	0.020	Q9VMP3_DROME Glutamate receptor IIB OS=Drosophila melanogaster OX=7227 GN=GluRIIB PE=1 SV=3
17	O94397	2.7	31.6	344	0.033	0.026	SGF73_SCHPO SAGA-associated factor 73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sgf73 PE=3 SV=1
18	Q9NSD4	3.4	31.6	429	0.073	0.047	ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens OX=9606 GN=ZNF275 PE=1 SV=2
19	O45028	5.2	31.2	913	0.066	0.020	O45028_DROME Glutamate receptor DGluRIIB OS=Drosophila melanogaster OX=7227 GN=GluRIIB PE=2 SV=1
20	Q7YU14	9.6	30.4	1312	0.059	0.012	Q7YU14_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Gcn2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12773 DZR	1.1e+02	14.2	Double zinc ribbon
2	PF05181 XPA_C	1.1e-23	94.1	XPA protein C-terminus
3	PF01286 XPA_N	4.1e-11	54.0	XPA protein N-terminal
4	PF18508 zf_C2H2_13	1.1e+02	13.8	Zinc finger domain
5	PF09723 Zn-ribbon_8	44	15.6	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364270

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000013807	0.999	DNA excision repair protein ERCC-1
2	9606.ENSP00000350708	0.998	UV excision repair protein RAD23 homolog B
3	9606.ENSP00000310520	0.997	DNA repair endonuclease XPF
4	9606.ENSP00000351137	0.997	Pre-mRNA-splicing factor SYF1
5	9606.ENSP00000363017	0.997	Replication protein A 32 kDa subunit
6	9606.ENSP00000254719	0.994	Replication protein A 70 kDa DNA-binding subunit
7	9606.ENSP00000375809	0.994	TFIIH basal transcription factor complex helicase XPD subunit
8	9606.ENSP00000285398	0.991	TFIIH basal transcription factor complex helicase XPB subunit
9	9606.ENSP00000476100	0.987	General transcription factor IIH subunit 5
10	9606.ENSP00000259895	0.983	General transcription factor IIH subunit 4
11	9606.ENSP00000347978	0.978	DNA repair protein complementing XP-G cells
12	9606.ENSP00000445162	0.978	General transcription factor IIH subunit 3
13	9606.ENSP00000328901	0.977	General transcription factor IIH subunit 2
14	9606.ENSP00000285021	0.976	DNA repair protein complementing XP-C cells
15	9606.ENSP00000256996	0.975	DNA damage-binding protein 2
16	9606.ENSP00000301764	0.975	DNA damage-binding protein 1
17	9606.ENSP00000355759	0.973	Poly [ADP-ribose] polymerase 1
18	9606.ENSP00000316176	0.963	Ubiquitin-conjugating enzyme E2 N
19	9606.ENSP00000265963	0.956	General transcription factor IIH subunit 1
20	9606.ENSP00000265081	0.952	DNA mismatch repair protein Msh3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003690	1.000	double-stranded DNA binding
GO:0003684	1.000	damaged DNA binding
GO:0019904	0.999	protein domain specific binding
GO:0042803	0.996	protein homodimerization activity
GO:0043565	0.995	sequence-specific DNA binding
GO:1990837	0.993	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006950	0.986	response to stress
GO:0051716	0.985	cellular response to stimulus
GO:0006974	0.983	cellular response to DNA damage stimulus
GO:0006807	0.979	nitrogen compound metabolic process
GO:0009628	0.975	response to abiotic stimulus
GO:0043170	0.966	macromolecule metabolic process
GO:0090304	0.955	nucleic acid metabolic process
GO:0006259	0.945	DNA metabolic process
GO:0006281	0.943	DNA repair
GO:0009411	0.854	response to UV
GO:0065007	0.543	biological regulation
GO:0050794	0.435	regulation of cellular process
GO:0019222	0.330	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0032991	0.979	protein-containing complex
GO:0005694	0.914	chromosome
GO:0140513	0.885	nuclear protein-containing complex
GO:0032993	0.686	protein-DNA complex
GO:0000228	0.674	nuclear chromosome
GO:0005657	0.652	replication fork
GO:0005737	0.561	cytoplasm
GO:0043596	0.529	nuclear replication fork
GO:0030894	0.485	replisome
GO:0005662	0.484	DNA replication factor A complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]