StarFunc result for job id P23229

User Input

>input (1130 residues)
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETEHDESLVPVPANSYLGLLFLTSVSYTDPDQFVYKTRPPREQPDTFPDVMMNSYLGFS
LDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGYDVA
VVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGRWNNVKPIRLNGTKDSMFGIAV
KNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMD
LDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKS
CFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKV
CMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHF
LKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNS
PSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFPEKQLSCVANQNGSQADCELGN
PFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSG
VAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLGKPLTNLGTATLNIQWPKEISN
GKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAER
KYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEEYSKLNYLDILMRAFIDV
TAAAENIRLPNAGTQVRVTVFPSKTVAQYSGVPWWIILVAILAGILMLALLVFILWKCGF
FKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQWITKWNENESYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8WHQ8	0.567	0.585	0.000	1092	0.602	0.623	A8WHQ8.pdb.gz	A8WHQ8_DANRE Integrin alpha-6 isoform X1 OS=Danio rerio OX=7955 GN=itga6a PE=1 SV=1
2	AFDB:D7PS99	0.668	0.719	0.000	1041	0.316	0.343	D7PS99.pdb.gz	D7PS99_DANRE Integrin alpha 3 protein OS=Danio rerio OX=7955 GN=im:7155971 PE=1 SV=1
3	AFDB:P23229	1.000	1.000	0.000	1130	1.000	1.000	P23229.pdb.gz	ITA6_HUMAN Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6 PE=1 SV=5
4	AFDB:P26007	0.558	0.587	0.000	1072	0.670	0.706	P26007.pdb.gz	ITA6_CHICK Integrin alpha-6 OS=Gallus gallus OX=9031 GN=ITGA6 PE=2 SV=1
5	AFDB:Q13683	0.571	0.548	0.000	1181	0.488	0.467	Q13683.pdb.gz	ITA7_HUMAN Integrin alpha-7 OS=Homo sapiens OX=9606 GN=ITGA7 PE=1 SV=3
6	AFDB:Q61738	0.594	0.572	0.000	1179	0.488	0.467	Q61738.pdb.gz	ITA7_MOUSE Integrin alpha-7 OS=Mus musculus OX=10090 GN=Itga7 PE=1 SV=3
7	AFDB:Q61739	0.559	0.579	0.000	1091	0.898	0.930	Q61739.pdb.gz	ITA6_MOUSE Integrin alpha-6 OS=Mus musculus OX=10090 GN=Itga6 PE=1 SV=3
8	AFDB:Q63258	0.539	0.537	0.000	1135	0.478	0.476	Q63258.pdb.gz	ITA7_RAT Integrin alpha-7 OS=Rattus norvegicus OX=10116 GN=Itga7 PE=1 SV=2
9	AFDB:P26006	0.548	0.586	1.310E-101	1051	0.348	0.374	P26006.pdb.gz	ITA3_HUMAN Integrin alpha-3 OS=Homo sapiens OX=9606 GN=ITGA3 PE=1 SV=5
10	AFDB:D3ZQM3	0.529	0.558	7.513E-101	1067	0.363	0.384	D3ZQM3.pdb.gz	D3ZQM3_RAT Integrin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Itga3 PE=3 SV=2
11	PDB:4g1eA	0.542	0.618	2.362E-75	964	0.240	0.281	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
12	PDB:7nxdA	0.459	0.567	1.455E-66	905	0.230	0.287	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
13	PDB:3fcsA	0.440	0.534	9.247E-66	913	0.198	0.245	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
14	PDB:7uslA	0.426	0.527	1.170E-56	856	0.183	0.242	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
15	PDB:4nehA	0.423	0.440	7.966E-54	1084	0.171	0.178	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
16	PDB:3k6sC	0.428	0.537	2.620E-52	885	0.169	0.216	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
17	PDB:4nenA	0.422	0.447	5.377E-52	1063	0.172	0.183	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
18	PDB:7sqcO0	0.095	0.095	7.515E-9	1140	0.052	0.052	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:7u05A	0.091	0.091	1.894E-8	1114	0.052	0.053	7u05A.pdb.gz
20	PDB:5a42A	0.094	0.076	7.582E-8	1597	0.104	0.073	5a42A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A5C8	0.0	1849	1073	0.792	0.834	A0A8I6A5C8_RAT Integrin subunit alpha 6 OS=Rattus norvegicus OX=10116 GN=Itga6 PE=1 SV=1
2	A0A8I6AJE9	0.0	2154	1129	0.922	0.923	A0A8I6AJE9_RAT Integrin subunit alpha 6 OS=Rattus norvegicus OX=10116 GN=Itga6 PE=1 SV=1
3	A0A8I6G9S4	0.0	1961	1061	0.847	0.902	A0A8I6G9S4_RAT Integrin subunit alpha 6 OS=Rattus norvegicus OX=10116 GN=Itga6 PE=1 SV=1
4	A0A8I6GLI8	0.0	578	1050	0.358	0.385	A0A8I6GLI8_RAT Integrin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Itga3 PE=3 SV=1
5	A8WHQ7	0.0	1296	1071	0.576	0.608	A8WHQ7_DANRE Integrin alpha-6 isoform X2 OS=Danio rerio OX=7955 GN=itga6a PE=1 SV=1
6	A8WHQ8	0.0	1356	1092	0.603	0.624	A8WHQ8_DANRE Integrin alpha-6 isoform X1 OS=Danio rerio OX=7955 GN=itga6a PE=1 SV=1
7	D3ZCG9	0.0	595	1052	0.362	0.389	D3ZCG9_RAT Integrin alpha 3 variant A OS=Rattus norvegicus OX=10116 GN=Itga3 PE=2 SV=1
8	D3ZQM3	0.0	574	1055	0.355	0.380	D3ZQM3_RAT Integrin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Itga3 PE=3 SV=2
9	G3V667	0.0	1989	1073	0.858	0.904	G3V667_RAT Integrin subunit alpha 6 OS=Rattus norvegicus OX=10116 GN=Itga6 PE=1 SV=1
10	I4DUB5	0.0	620	1067	0.370	0.392	I4DUB5_RAT Integrin alpha 3 variant B OS=Rattus norvegicus OX=10116 GN=Itga3 PE=2 SV=1
11	P23229	0.0	2346	1130	1.000	1.000	ITA6_HUMAN Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6 PE=1 SV=5
12	P26006	0.0	595	1051	0.366	0.394	ITA3_HUMAN Integrin alpha-3 OS=Homo sapiens OX=9606 GN=ITGA3 PE=1 SV=5
13	P26007	0.0	1543	1072	0.665	0.701	ITA6_CHICK Integrin alpha-6 OS=Gallus gallus OX=9031 GN=ITGA6 PE=2 SV=1
14	Q13683	0.0	1077	1181	0.494	0.472	ITA7_HUMAN Integrin alpha-7 OS=Homo sapiens OX=9606 GN=ITGA7 PE=1 SV=3
15	Q61738	0.0	1061	1179	0.492	0.472	ITA7_MOUSE Integrin alpha-7 OS=Mus musculus OX=10090 GN=Itga7 PE=1 SV=3
16	Q61739	0.0	2089	1091	0.899	0.931	ITA6_MOUSE Integrin alpha-6 OS=Mus musculus OX=10090 GN=Itga6 PE=1 SV=3
17	Q62470	0.0	596	1053	0.362	0.388	ITA3_MOUSE Integrin alpha-3 OS=Mus musculus OX=10090 GN=Itga3 PE=1 SV=1
18	Q63258	0.0	1004	1135	0.474	0.472	ITA7_RAT Integrin alpha-7 OS=Rattus norvegicus OX=10116 GN=Itga7 PE=1 SV=2
19	Q924W2	0.0	1791	974	0.775	0.899	Q924W2_RAT Integrin alpha 6 subchain (Fragment) OS=Rattus norvegicus OX=10116 GN=Itga6 PE=2 SV=1
20	F1R2R3	4.36e-178	551	1041	0.337	0.366	F1R2R3_DANRE Integrin alpha-3 isoform X1 OS=Danio rerio OX=7955 GN=im:7145180 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18967 DUF5706	7.8e+02	11.9	Family of unknown function (DUF5706)
2	PF01839 FG-GAP	2.6e-15	67.1	FG-GAP repeat
3	PF14312 FG-GAP_2	78	15.0	FG-GAP repeat
4	PF13517 FG-GAP_3	4.1e-09	48.2	FG-GAP-like repeat
5	PF00357 Integrin_alpha	94	14.4	Integrin alpha cytoplasmic region
6	PF08441 Integrin_alpha2	6.8e-132	452.5	Integrin alpha

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000007656

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000005989	0.996	Integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
2	9593.ENSGGOP00000009308	0.994	Integrin, beta 4
3	9593.ENSGGOP00000007587	0.984	Belongs to the integrin beta chain family.
4	9593.ENSGGOP00000009194	0.954	Belongs to the integrin beta chain family.
5	9593.ENSGGOP00000023681	0.951	Belongs to the integrin beta chain family.
6	9593.ENSGGOP00000025956	0.941	Laminin subunit alpha 3
7	9593.ENSGGOP00000006652	0.938	Belongs to the integrin beta chain family.
8	9593.ENSGGOP00000010471	0.923	Laminin, beta 1
9	9593.ENSGGOP00000014556	0.920	Laminin, beta 2 (laminin S)
10	9593.ENSGGOP00000020829	0.913	Laminin, alpha 1
11	9593.ENSGGOP00000014652	0.910	Laminin, alpha 4
12	9593.ENSGGOP00000014192	0.907	Laminin, gamma 2
13	9593.ENSGGOP00000008250	0.900	Laminin, beta 3
14	9593.ENSGGOP00000023953	0.893	Laminin, gamma 1 (formerly LAMB2)
15	9593.ENSGGOP00000014657	0.892	Fibronectin 1
16	9593.ENSGGOP00000012673	0.885	Thrombospondin 1
17	9593.ENSGGOP00000010546	0.884	Tetraspanin
18	9593.ENSGGOP00000016858	0.875	Collagen, type XVII, alpha 1
19	9593.ENSGGOP00000016752	0.872	Laminin, gamma 3
20	9593.ENSGGOP00000008324	0.867	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0043236	1.000	laminin binding
GO:0050839	0.960	cell adhesion molecule binding
GO:0005102	0.765	signaling receptor binding
GO:0005178	0.374	integrin binding
GO:0045296	0.327	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007155	0.996	cell adhesion
GO:0050794	0.995	regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0048522	0.986	positive regulation of cellular process
GO:0030155	0.950	regulation of cell adhesion
GO:0045785	0.936	positive regulation of cell adhesion
GO:0098609	0.934	cell-cell adhesion
GO:0051716	0.926	cellular response to stimulus
GO:0042221	0.878	response to chemical
GO:0010810	0.868	regulation of cell-substrate adhesion
GO:0010811	0.830	positive regulation of cell-substrate adhesion
GO:0048856	0.820	anatomical structure development
GO:0010033	0.725	response to organic substance
GO:0014070	0.712	response to organic cyclic compound
GO:0071310	0.706	cellular response to organic substance
GO:0071407	0.655	cellular response to organic cyclic compound
GO:0032501	0.531	multicellular organismal process
GO:0016043	0.505	cellular component organization
GO:0007275	0.495	multicellular organism development
GO:0007154	0.458	cell communication
GO:0009653	0.377	anatomical structure morphogenesis
GO:0048731	0.374	system development
GO:0048513	0.367	animal organ development
GO:0019222	0.306	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070161	0.998	anchoring junction
GO:0005886	0.998	plasma membrane
GO:0032991	0.997	protein-containing complex
GO:0120025	0.982	plasma membrane bounded cell projection
GO:0008305	0.955	integrin complex
GO:0009986	0.822	cell surface
GO:0005912	0.775	adherens junction
GO:0098858	0.749	actin-based cell projection
GO:0030175	0.741	filopodium
GO:0005622	0.702	intracellular anatomical structure
GO:0005925	0.670	focal adhesion
GO:0005737	0.668	cytoplasm
GO:0045202	0.431	synapse
GO:0098590	0.324	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]