StarFunc result for job id P23246

User Input

>input (707 residues)
MSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPI
PPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPG
VGSAPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQ
AGGPPPPPAAVPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE
PRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKANLSLLRRPGEKTYTQRCRLF
VGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGR
QLRVRFATHAAALSVRNLSPYVSNELLEEAFSQFGPIERAVVIVDDRGRSTGKGIVEFAS
KPAARKAFERCSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRF
AQHGTFEYEYSQRWKSLDEMEKQQREQVEKNMKDAKDKLESEMEDAYHEHQANLLRQDLM
RRQEELRRMEELHNQEMQKRKEMQLRQEEERRRREEEMMIRQREMEEQMRRQREESYSRM
GYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGS
DMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384N5Z8	0.472	0.472	1.983E-97	707	1.000	1.000	A0A384N5Z8.pdb.gz	A0A384N5Z8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q8R326	0.423	0.567	2.161E-49	523	0.416	0.562	Q8R326.pdb.gz	PSPC1_MOUSE Paraspeckle component 1 OS=Mus musculus OX=10090 GN=Pspc1 PE=1 SV=1
3	AFDB:Q802Z5	0.423	0.668	4.767E-46	441	0.369	0.592	Q802Z5.pdb.gz	Q802Z5_DANRE Non-POU domain-containing octamer-binding protein OS=Danio rerio OX=7955 GN=wu:fb40d10 PE=1 SV=1
4	AFDB:Q04047	0.435	0.439	2.301E-35	700	0.286	0.289	Q04047.pdb.gz	NONA_DROME Protein no-on-transient A OS=Drosophila melanogaster OX=7227 GN=nonA PE=1 SV=2
5	AFDB:Q9FVQ1	0.108	0.135	5.183E-12	557	0.112	0.142	Q9FVQ1.pdb.gz	NUCL1_ARATH Nucleolin 1 OS=Arabidopsis thaliana OX=3702 GN=NUCL1 PE=1 SV=1
6	AFDB:B3DH54	0.108	0.108	7.435E-12	708	0.113	0.113	B3DH54.pdb.gz
7	AFDB:P13383	0.116	0.116	2.331E-11	713	0.119	0.118	P13383.pdb.gz	NUCL_RAT Nucleolin OS=Rattus norvegicus OX=10116 GN=Ncl PE=1 SV=3
8	AFDB:P19338	0.121	0.121	2.965E-11	710	0.103	0.103	P19338.pdb.gz	NUCL_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3
9	AFDB:H7BY16	0.113	0.110	8.244E-11	734	0.112	0.108	H7BY16.pdb.gz	H7BY16_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=9
10	PDB:6y53o	0.105	0.438	1.047E-10	160	0.064	0.281	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
11	PDB:5vsuA	0.120	0.204	3.704E-10	387	0.052	0.096	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
12	AFDB:Q8IJI0	0.107	0.139	6.000E-10	538	0.064	0.084	Q8IJI0.pdb.gz	Q8IJI0_PLAF7 Serine/arginine-rich splicing factor 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1022400 PE=4 SV=1
13	PDB:6y5qq	0.099	0.357	7.495E-9	178	0.058	0.230	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:7oqcF	0.102	0.260	7.959E-9	267	0.048	0.127	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
15	PDB:6r5kH	0.110	0.188	8.310E-8	394	0.082	0.147	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
16	PDB:7evoD	0.098	0.329	1.516E-7	200	0.061	0.215	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:5lsbA	0.131	0.415	2.049E-7	176	0.044	0.176	5lsbA.pdb.gz
18	PDB:6ff7X	0.098	0.382	8.170E-7	171	0.042	0.175	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:1hl6A	0.104	0.565	1.300E-5	119	0.038	0.227	1hl6A.pdb.gz
20	PDB:7dvqY	0.100	0.483	1.653E-5	140	0.031	0.157	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384N5Z8	0.0	1373	707	1.000	1.000	A0A384N5Z8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	P23246	0.0	1373	707	1.000	1.000	SFPQ_HUMAN Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2
3	Q4KM71	0.0	813	699	0.669	0.677	Q4KM71_RAT Splicing factor proline and glutamine rich OS=Rattus norvegicus OX=10116 GN=Sfpq PE=1 SV=1
4	Q6NUU2	0.0	582	619	0.443	0.506	Q6NUU2_DANRE Splicing factor proline/glutamine rich (Polypyrimidine tract binding protein associated) OS=Danio rerio OX=7955 GN=zgc:85935 PE=1 SV=1
5	Q8VIJ6	0.0	812	699	0.669	0.677	SFPQ_MOUSE Splicing factor, proline- and glutamine-rich OS=Mus musculus OX=10090 GN=Sfpq PE=1 SV=1
6	Q8R326	2.24e-153	457	523	0.365	0.493	PSPC1_MOUSE Paraspeckle component 1 OS=Mus musculus OX=10090 GN=Pspc1 PE=1 SV=1
7	Q8WXF1	2.01e-151	452	523	0.355	0.480	PSPC1_HUMAN Paraspeckle component 1 OS=Homo sapiens OX=9606 GN=PSPC1 PE=1 SV=1
8	A0A0S2Z4Z9	1.81e-150	447	471	0.298	0.448	A0A0S2Z4Z9_HUMAN Non-POU domain containing octamer-binding isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=NONO PE=2 SV=1
9	Q15233	1.81e-150	447	471	0.298	0.448	NONO_HUMAN Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4
10	Q5FVM4	2.60e-150	447	476	0.298	0.443	NONO_RAT Non-POU domain-containing octamer-binding protein OS=Rattus norvegicus OX=10116 GN=Nono PE=1 SV=3
11	Q99K48	3.08e-150	447	473	0.298	0.446	NONO_MOUSE Non-POU domain-containing octamer-binding protein OS=Mus musculus OX=10090 GN=Nono PE=1 SV=3
12	Q802Z5	4.98e-148	440	441	0.293	0.469	Q802Z5_DANRE Non-POU domain-containing octamer-binding protein OS=Danio rerio OX=7955 GN=wu:fb40d10 PE=1 SV=1
13	Q04047	1.38e-81	275	700	0.207	0.209	NONA_DROME Protein no-on-transient A OS=Drosophila melanogaster OX=7227 GN=nonA PE=1 SV=2
14	B3GWA1	5.84e-81	270	562	0.185	0.233	B3GWA1_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nono-1 PE=1 SV=1
15	Q9U1N0	3.00e-80	267	535	0.191	0.252	HRP65_CHITE Hrp65 protein OS=Chironomus tentans OX=7153 GN=HRP65 PE=1 SV=1
16	Q8I7K5	2.48e-74	246	374	0.171	0.324	Q8I7K5_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nono-1 PE=1 SV=1
17	C9IZL7	1.21e-73	238	207	0.160	0.546	C9IZL7_HUMAN Non-POU domain-containing octamer-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=1
18	C9J4X2	1.88e-23	98.2	124	0.069	0.395	C9J4X2_HUMAN Non-POU domain-containing octamer-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=1
19	B3GWA0	7.46e-17	83.6	282	0.055	0.138	B3GWA0_CAEEL NOPS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nono-1 PE=1 SV=1
20	O22173	1.22e-14	80.1	662	0.075	0.080	PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana OX=3702 GN=PAB4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08075 NOPS	3.4e-24	96.1	NOPS (NUC059) domain
2	PF00076 RRM_1	9.2e-27	104.0	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16367 RRM_7	4.5	18.8	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349748

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276079	0.998	Non-POU domain-containing octamer-binding protein
2	9606.ENSP00000354346	0.998	Matrin-3
3	9606.ENSP00000349428	0.990	Polypyrimidine tract-binding protein 1
4	9606.ENSP00000378402	0.990	Paired amphipathic helix protein Sin3a
5	9606.ENSP00000341826	0.981	Heterogeneous nuclear ribonucleoprotein A1
6	9606.ENSP00000359216	0.980	Polypyrimidine tract-binding protein 2
7	9606.ENSP00000325376	0.976	Heterogeneous nuclear ribonucleoprotein M
8	9606.ENSP00000254108	0.963	RNA-binding protein FUS
9	9606.ENSP00000349168	0.960	Heterogeneous nuclear ribonucleoprotein H
10	9606.ENSP00000346694	0.951	Heterogeneous nuclear ribonucleoproteins A2/B1
11	9606.ENSP00000343966	0.948	Paraspeckle component 1
12	9606.ENSP00000365439	0.947	Heterogeneous nuclear ribonucleoprotein K
13	9606.ENSP00000362649	0.939	Histone deacetylase 1
14	9606.ENSP00000221419	0.935	Heterogeneous nuclear ribonucleoprotein L
15	9606.ENSP00000311747	0.935	RNA-binding protein 14
16	9606.ENSP00000355050	0.930	Beta-catenin-like protein 1
17	9606.ENSP00000442460	0.929	Protein-tyrosine kinase 6
18	9606.ENSP00000258962	0.923	Serine/arginine-rich splicing factor 1
19	9606.ENSP00000307863	0.918	Splicing factor U2AF 65 kDa subunit
20	9606.ENSP00000485396	0.917	Metastasis-associated lung adenocarcinoma transcript 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.477	mRNA binding
GO:0003677	0.439	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.997	regulation of metabolic process
GO:0009987	0.993	cellular process
GO:0044238	0.992	primary metabolic process
GO:0010468	0.988	regulation of gene expression
GO:0019219	0.987	regulation of nucleobase-containing compound metabolic process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0051252	0.980	regulation of RNA metabolic process
GO:0048523	0.971	negative regulation of cellular process
GO:0071704	0.970	organic substance metabolic process
GO:0009892	0.960	negative regulation of metabolic process
GO:2001141	0.955	regulation of RNA biosynthetic process
GO:0043170	0.953	macromolecule metabolic process
GO:0051172	0.951	negative regulation of nitrogen compound metabolic process
GO:0048518	0.949	positive regulation of biological process
GO:0031324	0.949	negative regulation of cellular metabolic process
GO:0006355	0.945	regulation of DNA-templated transcription
GO:0010605	0.941	negative regulation of macromolecule metabolic process
GO:0048522	0.933	positive regulation of cellular process
GO:0045934	0.933	negative regulation of nucleobase-containing compound metabolic process
GO:0044237	0.925	cellular metabolic process
GO:0051253	0.850	negative regulation of RNA metabolic process
GO:0010558	0.796	negative regulation of macromolecule biosynthetic process
GO:0031327	0.796	negative regulation of cellular biosynthetic process
GO:0034641	0.780	cellular nitrogen compound metabolic process
GO:0006139	0.773	nucleobase-containing compound metabolic process
GO:0090304	0.762	nucleic acid metabolic process
GO:0010467	0.708	gene expression
GO:0045892	0.638	negative regulation of DNA-templated transcription
GO:0016070	0.629	RNA metabolic process
GO:0008380	0.543	RNA splicing
GO:0006397	0.541	mRNA processing
GO:0048583	0.532	regulation of response to stimulus
GO:0071840	0.496	cellular component organization or biogenesis
GO:0080134	0.468	regulation of response to stress
GO:0009893	0.463	positive regulation of metabolic process
GO:0051173	0.452	positive regulation of nitrogen compound metabolic process
GO:0031325	0.450	positive regulation of cellular metabolic process
GO:0016043	0.445	cellular component organization
GO:0010604	0.443	positive regulation of macromolecule metabolic process
GO:0032101	0.431	regulation of response to external stimulus
GO:0050896	0.416	response to stimulus
GO:0000377	0.395	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0000398	0.394	mRNA splicing, via spliceosome
GO:0080135	0.393	regulation of cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.950	protein-containing complex
GO:0005737	0.730	cytoplasm
GO:0043232	0.554	intracellular non-membrane-bounded organelle
GO:0016604	0.484	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]