StarFunc result for job id P23258

User Input

>input (451 residues)
MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHY
IPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFD
IIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSD
VVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSAST
TTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQP
KNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVAL
SRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDE
MDTSREIVQQLIDEYHAATRPDYISWGTQEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23258	1.000	1.000	7.213E-94	451	1.000	1.000	P23258.pdb.gz	TBG1_HUMAN Tubulin gamma-1 chain OS=Homo sapiens OX=9606 GN=TUBG1 PE=1 SV=2
2	AFDB:P23257	0.986	0.936	6.277E-79	475	0.792	0.752	P23257.pdb.gz	TBG1_DROME Tubulin gamma-1 chain OS=Drosophila melanogaster OX=7227 GN=gammaTub23C PE=1 SV=2
3	AFDB:P38557	0.991	0.943	4.311E-78	474	0.745	0.709	P38557.pdb.gz	TBG1_ARATH Tubulin gamma-1 chain OS=Arabidopsis thaliana OX=3702 GN=TUBG1 PE=1 SV=1
4	AFDB:P42271	0.982	0.969	2.410E-76	457	0.774	0.764	P42271.pdb.gz	TBG2_DROME Tubulin gamma-2 chain OS=Drosophila melanogaster OX=7227 GN=gammaTub37C PE=1 SV=3
5	PDB:3cb2A	0.936	0.976	1.530E-74	432	0.951	0.993	3cb2A.pdb.gz	The lattice as allosteric effector: structural studies of alphabeta- and gamma-tubulin clarify the role of GTP in microtubule assembly
6	AFDB:P25295	0.974	0.985	1.161E-73	446	0.703	0.711	P25295.pdb.gz	TBG_SCHPO Tubulin gamma chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tug1 PE=3 SV=1
7	AFDB:P18695	0.973	0.967	1.081E-71	454	0.681	0.676	P18695.pdb.gz	TBG_EMENI Tubulin gamma chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mipA PE=2 SV=3
8	AFDB:Q55AR3	0.964	0.942	2.306E-70	462	0.652	0.636	Q55AR3.pdb.gz	TBG_DICDI Tubulin gamma chain OS=Dictyostelium discoideum OX=44689 GN=tubC PE=1 SV=1
9	AFDB:D6XD01	0.961	0.970	1.444E-68	447	0.672	0.678	D6XD01.pdb.gz	D6XD01_TRYB2 Tubulin gamma chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.510 PE=3 SV=1
10	PDB:6v6sk	0.802	0.974	2.412E-55	370	0.814	0.992	6v6sk.pdb.gz	Asymmetric Molecular Architecture of the Human gamma-Tubulin Ring Complex.
11	AFDB:P34475	0.941	0.956	1.936E-54	444	0.432	0.439	P34475.pdb.gz	TBG_CAEEL Tubulin gamma chain OS=Caenorhabditis elegans OX=6239 GN=tbg-1 PE=2 SV=1
12	AFDB:P54401	0.926	0.926	3.066E-51	451	0.435	0.435	P54401.pdb.gz	TBG_ENTH1 Tubulin gamma chain OS=Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) OX=294381 GN=G-TUB PE=1 SV=2
13	PDB:7m2wA	0.930	0.926	7.107E-44	453	0.399	0.397	7m2wA.pdb.gz	CM1-driven assembly and activation of yeast gamma-tubulin small complex underlies microtubule nucleation.
14	PDB:4i4tA	0.891	0.899	3.915E-40	447	0.306	0.309	4i4tA.pdb.gz	Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
15	PDB:7pqcA	0.877	0.888	1.709E-39	445	0.328	0.333	7pqcA.pdb.gz	A Structural Ensemble of a Tau-Microtubule Complex Reveals Regulatory Tau Phosphorylation and Acetylation Mechanisms.
16	PDB:5o091B	0.848	0.930	2.451E-38	410	0.337	0.371	5o091B.pdb.gz	Four-stranded mini microtubules formed by Prosthecobacter BtubAB show dynamic instability.
17	PDB:5w3fB	0.875	0.923	1.886E-37	427	0.341	0.361	5w3fB.pdb.gz	Structural differences between yeast and mammalian microtubules revealed by cryo-EM.
18	PDB:5w3fA	0.890	0.912	2.038E-36	440	0.315	0.323	5w3fA.pdb.gz	Structural differences between yeast and mammalian microtubules revealed by cryo-EM.
19	PDB:5mlvI	0.883	0.925	3.207E-36	430	0.339	0.356	5mlvI.pdb.gz
20	PDB:7un1KH	0.831	0.926	1.756E-35	403	0.326	0.365	7un1KH.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6XD01	0.0	639	447	0.674	0.680	D6XD01_TRYB2 Tubulin gamma chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.510 PE=3 SV=1
2	P18695	0.0	662	454	0.678	0.674	TBG_EMENI Tubulin gamma chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mipA PE=2 SV=3
3	P23257	0.0	766	475	0.792	0.752	TBG1_DROME Tubulin gamma-1 chain OS=Drosophila melanogaster OX=7227 GN=gammaTub23C PE=1 SV=2
4	P23258	0.0	944	451	1.000	1.000	TBG1_HUMAN Tubulin gamma-1 chain OS=Homo sapiens OX=9606 GN=TUBG1 PE=1 SV=2
5	P25295	0.0	678	446	0.703	0.711	TBG_SCHPO Tubulin gamma chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tug1 PE=3 SV=1
6	P38557	0.0	717	474	0.747	0.711	TBG1_ARATH Tubulin gamma-1 chain OS=Arabidopsis thaliana OX=3702 GN=TUBG1 PE=1 SV=1
7	P38558	0.0	722	474	0.754	0.717	TBG2_ARATH Tubulin gamma-2 chain OS=Arabidopsis thaliana OX=3702 GN=TUBG2 PE=1 SV=1
8	P42271	0.0	754	457	0.774	0.764	TBG2_DROME Tubulin gamma-2 chain OS=Drosophila melanogaster OX=7227 GN=gammaTub37C PE=1 SV=3
9	P83887	0.0	934	451	0.989	0.989	TBG1_MOUSE Tubulin gamma-1 chain OS=Mus musculus OX=10090 GN=Tubg1 PE=1 SV=1
10	P83888	0.0	934	451	0.989	0.989	TBG1_RAT Tubulin gamma-1 chain OS=Rattus norvegicus OX=10116 GN=Tubg1 PE=2 SV=1
11	Q55AR3	0.0	606	462	0.659	0.643	TBG_DICDI Tubulin gamma chain OS=Dictyostelium discoideum OX=44689 GN=tubC PE=1 SV=1
12	Q8VCK3	0.0	914	451	0.969	0.969	TBG2_MOUSE Tubulin gamma-2 chain OS=Mus musculus OX=10090 GN=Tubg2 PE=1 SV=1
13	Q94771	0.0	639	447	0.674	0.680	Q94771_9TRYP Tubulin gamma chain OS=Trypanosoma brucei OX=5691 PE=3 SV=1
14	Q9NRH3	0.0	926	451	0.978	0.978	TBG2_HUMAN Tubulin gamma-2 chain OS=Homo sapiens OX=9606 GN=TUBG2 PE=2 SV=1
15	P54401	2.84e-126	375	451	0.439	0.439	TBG_ENTH1 Tubulin gamma chain OS=Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) OX=294381 GN=G-TUB PE=1 SV=2
16	P34475	4.77e-123	367	444	0.439	0.446	TBG_CAEEL Tubulin gamma chain OS=Caenorhabditis elegans OX=6239 GN=tbg-1 PE=2 SV=1
17	P53378	4.76e-113	342	473	0.401	0.383	TBG_YEAST Tubulin gamma chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUB4 PE=1 SV=1
18	Q8H6N0	1.13e-93	291	444	0.357	0.363	Q8H6N0_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 GN=BTub1 PE=2 SV=1
19	A0A1D8PC97	2.21e-93	291	449	0.355	0.356	A0A1D8PC97_CANAL Tubulin beta chain OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TUB2 PE=3 SV=1
20	P10653	1.75e-92	288	447	0.348	0.351	TBB1_EMENI Tubulin beta-1 chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=benA PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10644 Misat_Tub_SegII	1.1	21.0	Misato Segment II tubulin-like domain
2	PF00091 Tubulin	1.7e-66	235.7	Tubulin/FtsZ family, GTPase domain
3	PF13809 Tubulin_2	2.8e+02	12.1	Tubulin like
4	PF03953 Tubulin_C	3.4e-45	164.7	Tubulin C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000014274

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000491	0.988	Gamma-tubulin complex component
2	61853.ENSNLEP00000002536	0.981	Gamma-tubulin complex component
3	61853.ENSNLEP00000006057	0.977	Gamma-tubulin complex component
4	61853.ENSNLEP00000000572	0.973	Gamma-tubulin complex component
5	61853.ENSNLEP00000013446	0.967	Gamma-tubulin complex component
6	61853.ENSNLEP00000019405	0.950	Mitotic spindle organizing protein 1
7	61853.ENSNLEP00000016700	0.874	Centromere protein J
8	61853.ENSNLEP00000007207	0.865	Neural precursor cell expressed, developmentally down-regulated 1
9	61853.ENSNLEP00000012816	0.816	Uncharacterized protein
10	61853.ENSNLEP00000014631	0.781	Breast cancer type 1 susceptibility protein homolog
11	61853.ENSNLEP00000001364	0.770	annotation not available
12	61853.ENSNLEP00000017687	0.770	Uncharacterized protein
13	61853.ENSNLEP00000020672	0.748	CDK5 regulatory subunit associated protein 2
14	61853.ENSNLEP00000019042	0.717	Ninein-like
15	61853.ENSNLEP00000021307	0.711	HAUS augmin-like complex, subunit 6
16	61853.ENSNLEP00000010570	0.706	Centrosomal protein 135kDa
17	61853.ENSNLEP00000015237	0.697	Centriolar coiled coil protein 110kDa
18	61853.ENSNLEP00000003979	0.685	Kinesin-like protein
19	61853.ENSNLEP00000010110	0.685	Kinesin-like protein
20	61853.ENSNLEP00000016664	0.683	Polo-like kinase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.999	structural molecule activity
GO:0005200	0.993	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.998	cellular component organization
GO:0006996	0.993	organelle organization
GO:0007017	0.979	microtubule-based process
GO:0022607	0.955	cellular component assembly
GO:0000226	0.891	microtubule cytoskeleton organization
GO:0031109	0.769	microtubule polymerization or depolymerization
GO:0043933	0.700	protein-containing complex organization
GO:0065003	0.680	protein-containing complex assembly
GO:0051258	0.671	protein polymerization
GO:0097435	0.659	supramolecular fiber organization
GO:0007020	0.609	microtubule nucleation
GO:0050794	0.509	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015630	1.000	microtubule cytoskeleton
GO:0005829	0.996	cytosol
GO:0032991	0.994	protein-containing complex
GO:0005874	0.985	microtubule
GO:0005815	0.983	microtubule organizing center
GO:0043231	0.948	intracellular membrane-bounded organelle
GO:0005813	0.912	centrosome
GO:0005634	0.798	nucleus
GO:0005819	0.680	spindle
GO:0031974	0.475	membrane-enclosed lumen
GO:0070013	0.473	intracellular organelle lumen
GO:0005876	0.330	spindle microtubule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]