StarFunc result for job id P23280

User Input

>input (308 residues)
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSE
ISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF
ISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS
RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEIL
DYLRRALN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23280	1.000	1.000	2.336E-69	308	1.000	1.000	P23280.pdb.gz	CAH6_HUMAN Carbonic anhydrase 6 OS=Homo sapiens OX=9606 GN=CA6 PE=1 SV=3
2	PDB:3fe4B	0.775	0.971	6.126E-52	245	0.789	0.992	3fe4B.pdb.gz	Crystal structure of the secretory isozyme of mammalian carbonic anhydrases CA VI: implications for biological assembly and inhibitor development
3	AFDB:P18761	0.838	0.815	4.122E-46	317	0.510	0.495	P18761.pdb.gz	CAH6_MOUSE Carbonic anhydrase 6 OS=Mus musculus OX=10090 GN=Ca6 PE=1 SV=3
4	AFDB:E7F742	0.820	0.477	1.037E-41	538	0.516	0.296	E7F742.pdb.gz
5	AFDB:A2IBE0	0.805	0.738	5.793E-36	337	0.370	0.338	A2IBE0.pdb.gz	A2IBE0_RAT Membrane-bound carbonic anhydrase 14 OS=Rattus norvegicus OX=10116 GN=Car14 PE=2 SV=1
6	AFDB:Q9ULX7	0.802	0.735	1.416E-35	337	0.370	0.338	Q9ULX7.pdb.gz	CAH14_HUMAN Carbonic anhydrase 14 OS=Homo sapiens OX=9606 GN=CA14 PE=1 SV=1
7	AFDB:O43570	0.799	0.697	3.676E-35	354	0.360	0.314	O43570.pdb.gz	CAH12_HUMAN Carbonic anhydrase 12 OS=Homo sapiens OX=9606 GN=CA12 PE=1 SV=1
8	AFDB:F7FL00	0.807	0.573	1.075E-34	437	0.370	0.261	F7FL00.pdb.gz	F7FL00_RAT Carbonic anhydrase OS=Rattus norvegicus OX=10116 GN=Car9 PE=2 SV=2
9	AFDB:A2IBE2	0.822	0.718	5.374E-34	354	0.360	0.314	A2IBE2.pdb.gz	A2IBE2_RAT Carbonic anhydrase OS=Rattus norvegicus OX=10116 GN=Car12 PE=2 SV=1
10	AFDB:Q16790	0.777	0.526	1.879E-33	459	0.341	0.229	Q16790.pdb.gz	CAH9_HUMAN Carbonic anhydrase 9 OS=Homo sapiens OX=9606 GN=CA9 PE=1 SV=2
11	AFDB:Q92051	0.762	0.898	7.567E-32	260	0.302	0.358	Q92051.pdb.gz	CAHZ_DANRE Carbonic anhydrase OS=Danio rerio OX=7955 GN=cahz PE=1 SV=2
12	PDB:3ml5A	0.748	0.875	2.115E-30	262	0.305	0.359	3ml5A.pdb.gz	Crystal structure of the C183S/C217S mutant of human CA VII in complex with acetazolamide
13	PDB:6nj4A	0.769	0.889	2.115E-30	265	0.295	0.343	6nj4A.pdb.gz	Immobilization of Proteins with Controlled Load and Orientation.
14	PDB:1z93A	0.755	0.878	2.383E-30	263	0.276	0.323	1z93A.pdb.gz	Human Carbonic Anhydrase III: Structural and Kinetic Study of Catalysis and Proton Transfer
15	PDB:3d0nA	0.758	0.883	3.407E-30	263	0.279	0.327	3d0nA.pdb.gz	Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide.
16	PDB:1bzmA	0.760	0.894	4.981E-29	260	0.260	0.308	1bzmA.pdb.gz	Drug-protein interactions. Refined structures of three sulfonamide drug complexes of human carbonic anhydrase I enzyme.
17	PDB:2w2jA	0.739	0.844	5.957E-29	268	0.263	0.302	2w2jA.pdb.gz
18	PDB:5jn8C	0.729	0.847	5.405E-28	264	0.273	0.318	5jn8C.pdb.gz	Intrinsic thermodynamics of high affinity inhibitor binding to recombinant human carbonic anhydrase IV.
19	PDB:3zncA	0.722	0.884	1.403E-27	250	0.269	0.332	3zncA.pdb.gz	Structures of murine carbonic anhydrase IV and human carbonic anhydrase II complexed with brinzolamide: molecular basis of isozyme-drug discrimination.
20	PDB:4twlA	0.660	0.838	9.368E-22	239	0.201	0.259	4twlA.pdb.gz	Yam Tuber Storage Protein Reduces Plant Oxidants Using the Coupled Reactions as Carbonic Anhydrase and Dehydroascorbate Reductase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23280	0.0	647	308	1.000	1.000	CAH6_HUMAN Carbonic anhydrase 6 OS=Homo sapiens OX=9606 GN=CA6 PE=1 SV=3
2	P18761	1.30e-115	338	317	0.526	0.511	CAH6_MOUSE Carbonic anhydrase 6 OS=Mus musculus OX=10090 GN=Ca6 PE=1 SV=3
3	E9QB97	2.37e-99	303	530	0.529	0.308	E9QB97_DANRE Carbonic anhydrase OS=Danio rerio OX=7955 GN=ca6 PE=1 SV=1
4	Q8VHB5	1.20e-65	214	437	0.364	0.256	CAH9_MOUSE Carbonic anhydrase 9 OS=Mus musculus OX=10090 GN=Ca9 PE=2 SV=2
5	F7FL00	1.93e-64	211	454	0.357	0.242	F7FL00_RAT Carbonic anhydrase OS=Rattus norvegicus OX=10116 GN=Car9 PE=2 SV=2
6	Q16790	1.64e-60	201	459	0.334	0.224	CAH9_HUMAN Carbonic anhydrase 9 OS=Homo sapiens OX=9606 GN=CA9 PE=1 SV=2
7	Q9ULX7	8.42e-58	191	337	0.373	0.341	CAH14_HUMAN Carbonic anhydrase 14 OS=Homo sapiens OX=9606 GN=CA14 PE=1 SV=1
8	A2IBE0	2.63e-56	187	337	0.357	0.326	A2IBE0_RAT Membrane-bound carbonic anhydrase 14 OS=Rattus norvegicus OX=10116 GN=Car14 PE=2 SV=1
9	Q9WVT6	2.81e-56	187	337	0.354	0.323	CAH14_MOUSE Carbonic anhydrase 14 OS=Mus musculus OX=10090 GN=Ca14 PE=1 SV=1
10	F7F6N9	1.04e-55	185	341	0.334	0.302	F7F6N9_RAT Carbonic anhydrase 14 OS=Rattus norvegicus OX=10116 GN=Car14 PE=1 SV=1
11	A0A8I6AM42	1.17e-55	185	344	0.334	0.299	A0A8I6AM42_RAT Carbonic anhydrase 14 OS=Rattus norvegicus OX=10116 GN=Car14 PE=1 SV=1
12	O43570	2.85e-55	184	354	0.338	0.294	CAH12_HUMAN Carbonic anhydrase 12 OS=Homo sapiens OX=9606 GN=CA12 PE=1 SV=1
13	A0A8I6AHH2	5.93e-55	184	363	0.325	0.275	A0A8I6AHH2_RAT Carbonic anhydrase 14 OS=Rattus norvegicus OX=10116 GN=Car14 PE=1 SV=1
14	Q8CI85	1.25e-54	183	354	0.347	0.302	CAH12_MOUSE Carbonic anhydrase 12 OS=Mus musculus OX=10090 GN=Ca12 PE=1 SV=1
15	A0A8I6AH35	6.97e-54	181	344	0.328	0.294	A0A8I6AH35_RAT Carbonic anhydrase OS=Rattus norvegicus OX=10116 GN=Car12 PE=3 SV=1
16	F7FAJ9	7.62e-54	181	355	0.328	0.285	F7FAJ9_RAT Carbonic anhydrase OS=Rattus norvegicus OX=10116 GN=Car12 PE=3 SV=1
17	A2IBE2	7.92e-54	181	354	0.328	0.285	A2IBE2_RAT Carbonic anhydrase OS=Rattus norvegicus OX=10116 GN=Car12 PE=2 SV=1
18	A0A8I6A8W4	1.57e-53	179	324	0.321	0.306	A0A8I6A8W4_RAT Carbonic anhydrase 14 OS=Rattus norvegicus OX=10116 GN=Car14 PE=1 SV=1
19	A0A8I6GAJ9	2.02e-53	179	333	0.318	0.294	A0A8I6GAJ9_RAT Carbonic anhydrase 14 OS=Rattus norvegicus OX=10116 GN=Car14 PE=1 SV=1
20	A0A8I6A5P9	2.75e-52	177	352	0.315	0.276	A0A8I6A5P9_RAT Carbonic anhydrase OS=Rattus norvegicus OX=10116 GN=Car12 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00194 Carb_anhydrase	1.8e-85	298.2	Eukaryotic-type carbonic anhydrase
2	PF09202 Rio2_N	3.5e+02	12.9	Rio2, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008973903.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003822167.1	0.687	Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family
2	9597.XP_003827565.1	0.670	Belongs to the cytochrome P450 family.
3	9597.XP_003816242.1	0.667	Carbohydrate sulfotransferase 8
4	9597.XP_003830316.1	0.662	Carbohydrate sulfotransferase 9
5	9597.XP_008958220.1	0.590	Uncharacterized protein LOC100974038
6	9597.XP_003814775.1	0.586	BPI fold containing family A member 2
7	9597.XP_008973987.1	0.577	Probable G-protein coupled receptor 157
8	9597.XP_003811144.1	0.560	C-src tyrosine kinase
9	9597.XP_003819312.1	0.560	Megakaryocyte-associated tyrosine-protein kinase isoform X1
10	9597.XP_003822657.1	0.540	SH3 domain containing GRB2 like 2, endophilin A1
11	9597.XP_003813418.1	0.516	Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004089	1.000	carbonate dehydratase activity
GO:0005515	0.979	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.969	multicellular organismal process
GO:0050896	0.862	response to stimulus
GO:0042221	0.724	response to chemical
GO:0050907	0.713	detection of chemical stimulus involved in sensory perception
GO:0050913	0.706	sensory perception of bitter taste
GO:0009987	0.623	cellular process
GO:0050912	0.620	detection of chemical stimulus involved in sensory perception of taste
GO:0065007	0.323	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.995	membrane-bounded organelle
GO:0005576	0.965	extracellular region
GO:0005615	0.932	extracellular space
GO:0070062	0.912	extracellular exosome
GO:0016020	0.863	membrane
GO:0005622	0.715	intracellular anatomical structure
GO:0043229	0.596	intracellular organelle
GO:0005886	0.546	plasma membrane
GO:0043231	0.473	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10748	1.000	H(+) + hydrogencarbonate = CO2 + H2O
EC:4.2.1.1	1.000	carbonic anhydrase.

[back to server]