StarFunc result for job id P23297

User Input

>input (94 residues)
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMK
ELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T7Y6	0.978	0.630	1.141E-14	147	1.000	0.639	Q5T7Y6.pdb.gz	Q5T7Y6_HUMAN Protein S100 OS=Homo sapiens OX=9606 GN=S100A1 PE=1 SV=1
2	PDB:2k2fA	0.806	0.814	3.796E-11	93	0.926	0.935	2k2fA.pdb.gz	S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
3	AFDB:A0A060WYU6	0.902	0.884	1.916E-10	96	0.702	0.688	A0A060WYU6.pdb.gz	A0A060WYU6_ONCMY Protein S100 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00052820001 PE=3 SV=1
4	AFDB:A0A0S2Z4C5	0.944	0.964	7.832E-10	92	0.564	0.576	A0A0S2Z4C5.pdb.gz	A0A0S2Z4C5_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100B PE=2 SV=1
5	AFDB:Q8WXG8	0.956	0.908	9.490E-10	99	0.574	0.545	Q8WXG8.pdb.gz	S100Z_HUMAN Protein S100-Z OS=Homo sapiens OX=9606 GN=S100Z PE=1 SV=4
6	AFDB:P29034	0.932	0.895	1.150E-9	98	0.500	0.480	P29034.pdb.gz	S10A2_HUMAN Protein S100-A2 OS=Homo sapiens OX=9606 GN=S100A2 PE=1 SV=3
7	PDB:7psqG	0.874	0.768	2.140E-9	108	0.489	0.426	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
8	PDB:5csnA	0.886	0.886	2.432E-9	94	0.564	0.564	5csnA.pdb.gz	Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
9	AFDB:P05942	0.906	0.846	1.488E-8	101	0.479	0.446	P05942.pdb.gz	S10A4_RAT Protein S100-A4 OS=Rattus norvegicus OX=10116 GN=S100a4 PE=2 SV=1
10	AFDB:P31725	0.972	0.812	1.586E-8	113	0.330	0.274	P31725.pdb.gz	S10A9_MOUSE Protein S100-A9 OS=Mus musculus OX=10090 GN=S100a9 PE=1 SV=3
11	AFDB:Q5XJJ5	0.932	0.862	1.586E-8	102	0.553	0.510	Q5XJJ5.pdb.gz	Q5XJJ5_DANRE Protein S100 OS=Danio rerio OX=7955 GN=zgc:101880 PE=2 SV=1
12	AFDB:P63084	0.851	0.860	1.922E-8	93	0.447	0.452	P63084.pdb.gz	S10A5_MOUSE Protein S100-A5 OS=Mus musculus OX=10090 GN=S100a5 PE=3 SV=1
13	AFDB:P25815	0.928	0.918	2.821E-8	95	0.521	0.516	P25815.pdb.gz	S100P_HUMAN Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2
14	PDB:6zdyA	0.898	0.785	8.218E-8	108	0.309	0.269	6zdyA.pdb.gz	Divalent cations influence the dimerization mode of murine S100A9 protein by modulating its disulfide bond pattern.
15	PDB:1k96A	0.823	0.868	1.207E-7	89	0.436	0.461	1k96A.pdb.gz	Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
16	PDB:5hydA	0.626	0.616	1.371E-7	96	0.564	0.552	5hydA.pdb.gz
17	PDB:2lucA	0.869	0.783	1.662E-7	105	0.404	0.362	2lucA.pdb.gz
18	PDB:2kayA	0.873	0.891	5.606E-7	92	0.457	0.467	2kayA.pdb.gz	Solution structure and dynamics of S100A5 in the apo and Ca2+-bound states
19	PDB:7nmiB	0.910	0.184	5.976E-7	488	0.521	0.100	7nmiB.pdb.gz	Transactivation domain of p53 in complex with S100P using annexin A2 as a crystallization chaperone
20	PDB:5hloC	0.862	0.871	7.720E-7	93	0.340	0.344	5hloC.pdb.gz	Crystal structure of human S100A8 in complex with zinc and calcium.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T7Y6	8.28e-66	196	147	1.000	0.639	Q5T7Y6_HUMAN Protein S100 OS=Homo sapiens OX=9606 GN=S100A1 PE=1 SV=1
2	A0A0S2Z4H2	6.55e-64	189	94	1.000	1.000	A0A0S2Z4H2_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100A1 PE=2 SV=1
3	P23297	6.55e-64	189	94	1.000	1.000	S10A1_HUMAN Protein S100-A1 OS=Homo sapiens OX=9606 GN=S100A1 PE=1 SV=2
4	P02639	2.95e-63	188	94	0.989	0.989	S10A1_BOVIN Protein S100-A1 OS=Bos taurus OX=9913 GN=S100A1 PE=1 SV=2
5	P35467	1.90e-60	181	94	0.936	0.936	S10A1_RAT Protein S100-A1 OS=Rattus norvegicus OX=10116 GN=S100a1 PE=1 SV=3
6	P56565	1.56e-59	178	94	0.926	0.926	S10A1_MOUSE Protein S100-A1 OS=Mus musculus OX=10090 GN=S100a1 PE=1 SV=2
7	A0A060WZ60	1.10e-41	133	96	0.713	0.698	A0A060WZ60_ONCMY Protein S100 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00063160001 PE=3 SV=1
8	Q8WXG8	1.72e-34	115	99	0.574	0.545	S100Z_HUMAN Protein S100-Z OS=Homo sapiens OX=9606 GN=S100Z PE=1 SV=4
9	Q5XJJ5	4.03e-33	112	102	0.553	0.510	Q5XJJ5_DANRE Protein S100 OS=Danio rerio OX=7955 GN=zgc:101880 PE=2 SV=1
10	P50114	1.94e-32	110	92	0.574	0.587	S100B_MOUSE Protein S100-B OS=Mus musculus OX=10090 GN=S100b PE=1 SV=2
11	P04631	5.15e-32	109	92	0.564	0.576	S100B_RAT Protein S100-B OS=Rattus norvegicus OX=10116 GN=S100b PE=1 SV=2
12	A0A060WYU6	7.19e-32	108	96	0.702	0.688	A0A060WYU6_ONCMY Protein S100 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00052820001 PE=3 SV=1
13	A0A0S2Z4C5	1.43e-31	108	92	0.564	0.576	A0A0S2Z4C5_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100B PE=2 SV=1
14	P04271	1.43e-31	108	92	0.564	0.576	S100B_HUMAN Protein S100-B OS=Homo sapiens OX=9606 GN=S100B PE=1 SV=2
15	P02638	4.31e-31	106	92	0.553	0.565	S100B_BOVIN Protein S100-B OS=Bos taurus OX=9913 GN=S100B PE=1 SV=2
16	P25815	9.98e-30	103	95	0.521	0.516	S100P_HUMAN Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2
17	P07091	1.27e-28	100	101	0.500	0.465	S10A4_MOUSE Protein S100-A4 OS=Mus musculus OX=10090 GN=S100a4 PE=1 SV=1
18	P26447	1.87e-28	100	101	0.489	0.455	S10A4_HUMAN Protein S100-A4 OS=Homo sapiens OX=9606 GN=S100A4 PE=1 SV=1
19	P29034	1.60e-27	97.8	98	0.500	0.480	S10A2_HUMAN Protein S100-A2 OS=Homo sapiens OX=9606 GN=S100A2 PE=1 SV=3
20	P05942	2.14e-27	97.8	101	0.479	0.446	S10A4_RAT Protein S100-A4 OS=Rattus norvegicus OX=10116 GN=S100a4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	0.00038	30.8	EF hand
2	PF12763 EF-hand_4	2.7e+02	12.9	Cytoskeletal-regulatory complex EF hand
3	PF13202 EF-hand_5	0.046	24.4	EF hand
4	PF13405 EF-hand_6	0.16	22.9	EF-hand domain
5	PF13499 EF-hand_7	0.00034	32.3	EF-hand domain pair
6	PF13833 EF-hand_8	2.6	19.2	EF-hand domain pair
7	PF01023 S_100	2.8e-18	76.6	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000012677

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007800	0.986	Peptidylprolyl isomerase D
2	61853.ENSNLEP00000003480	0.984	Peptidylprolyl isomerase
3	61853.ENSNLEP00000007754	0.912	Uncharacterized protein
4	61853.ENSNLEP00000007762	0.912	Uncharacterized protein
5	61853.ENSNLEP00000020469	0.903	Uncharacterized protein
6	61853.ENSNLEP00000004024	0.860	S100 calcium binding protein B
7	61853.ENSNLEP00000019365	0.834	Heat shock protein 90kDa alpha (cytosolic), class A member 1
8	61853.ENSNLEP00000004362	0.830	Ryanodine receptor 2 (cardiac)
9	61853.ENSNLEP00000010676	0.813	Peptidylprolyl isomerase
10	61853.ENSNLEP00000013874	0.802	Heat shock protein 90kDa alpha (cytosolic), class B member 1
11	61853.ENSNLEP00000014337	0.791	S100 calcium binding protein P
12	61853.ENSNLEP00000013043	0.773	Ryanodine receptor 3
13	61853.ENSNLEP00000012660	0.749	S100 calcium binding protein A4
14	61853.ENSNLEP00000005961	0.747	Peptidylprolyl isomerase G (cyclophilin G)
15	61853.ENSNLEP00000007084	0.747	Natural killer cell triggering receptor
16	61853.ENSNLEP00000009039	0.745	Belongs to the heat shock protein 70 family.
17	61853.ENSNLEP00000005108	0.735	Capping actin protein of muscle Z-line alpha subunit 1
18	61853.ENSNLEP00000001033	0.700	Transient receptor potential cation channel, subfamily M, member 3
19	61853.ENSNLEP00000011861	0.670	Cellular tumor antigen p53
20	61853.ENSNLEP00000003277	0.667	Calcium-transporting ATPase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005509	0.993	calcium ion binding
GO:0042802	0.844	identical protein binding
GO:0046983	0.557	protein dimerization activity
GO:0042803	0.472	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.957	regulation of biological process
GO:0044093	0.952	positive regulation of molecular function
GO:0048856	0.771	anatomical structure development
GO:0051239	0.743	regulation of multicellular organismal process
GO:1903670	0.720	regulation of sprouting angiogenesis
GO:0048857	0.689	neural nucleus development
GO:0007275	0.682	multicellular organism development
GO:0048513	0.669	animal organ development
GO:0007420	0.646	brain development
GO:0009987	0.599	cellular process
GO:0051341	0.562	regulation of oxidoreductase activity
GO:0030901	0.562	midbrain development
GO:0048518	0.517	positive regulation of biological process
GO:0051353	0.418	positive regulation of oxidoreductase activity
GO:0050794	0.346	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0043227	0.995	membrane-bounded organelle
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005634	0.959	nucleus
GO:0012505	0.922	endomembrane system
GO:0005829	0.919	cytosol
GO:0031981	0.775	nuclear lumen
GO:0005654	0.704	nucleoplasm
GO:0005794	0.647	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]