StarFunc result for job id P23327

User Input

>input (699 residues)
MGHHRPWLHASVLWAGVASLLLPPAMTQQLRGDGLGFRNRNNSTGVAGLSEEASAELRHH
LHSPRDHPDENKDVSTENGHHFWSHPDREKEDEDVSKEYGHLLPGHRSQDHKVGDEGVSG
EEVFAEHGGQARGHRGHGSEDTEDSAEHRHHLPSHRSHSHQDEDEDEVVSSEHHHHILRH
GHRGHDGEDDEGEEEEEEEEEEEEASTEYGHQAHRHRGHGSEEDEDVSDGHHHHGPSHRH
QGHEEDDDDDDDDDDDDDDDDVSIEYRHQAHRHQGHGIEEDEDVSDGHHHRDPSHRHRSH
EEDDNDDDDVSTEYGHQAHRHQDHRKEEVEAVSGEHHHHVPDHRHQGHRDEEEDEDVSTE
RWHQGPQHVHHGLVDEEEEEEEITVQFGHYVASHQPRGHKSDEEDFQDEYKTEVPHHHHH
RVPREEDEEVSAELGHQAPSHRQSHQDEETGHGQRGSIKEMSHHPPGHTVVKDRSHLRKD
DSEEEKEKEEDPGSHEEDDESSEQGEKGTHHGSRDQEDEEDEEEGHGLSLNQEEEEEEDK
EEEEEEEDEERREERAEVGAPLSPDHSEEEEEEEEGLEEDEPRFTIIPNPLDRREEAGGA
SSEEESGEDTGPQDAQEYGNYQPGSLCGYCSFCNRCTECESCHCDEENMGEHCDQCQHCQ
FCYLCPLVCETVCAPGSYVDYFSSSLYQALADMLETPEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23327	0.999	0.999	2.256E-88	699	1.000	1.000	P23327.pdb.gz	SRCH_HUMAN Sarcoplasmic reticulum histidine-rich calcium-binding protein OS=Homo sapiens OX=9606 GN=HRC PE=1 SV=1
2	AFDB:G5E8J6	0.199	0.190	2.531E-33	738	0.524	0.496	G5E8J6.pdb.gz	G5E8J6_MOUSE Histidine rich calcium binding protein OS=Mus musculus OX=10090 GN=Hrc PE=1 SV=1
3	AFDB:F1QM29	0.075	0.043	6.264E-1	1413	0.186	0.092	F1QM29.pdb.gz	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
4	AFDB:D3Z8E6	0.046	0.026	7.115E-1	1604	0.156	0.068	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
5	AFDB:A0A024RA49	0.052	0.036	9.179E-1	1124	0.127	0.079	A0A024RA49.pdb.gz
6	AFDB:Q3UHX0	0.059	0.040	9.179E-1	1147	0.137	0.084	Q3UHX0.pdb.gz	NOL8_MOUSE Nucleolar protein 8 OS=Mus musculus OX=10090 GN=Nol8 PE=1 SV=2
7	AFDB:Q8CHH5	0.053	0.039	1.111	1074	0.136	0.088	Q8CHH5.pdb.gz	BICRL_MOUSE BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Mus musculus OX=10090 GN=Bicral PE=1 SV=2
8	AFDB:Q8JGS1	0.073	0.046	1.434	1263	0.132	0.073	Q8JGS1.pdb.gz	STIL_DANRE SCL-interrupting locus protein homolog OS=Danio rerio OX=7955 GN=stil PE=1 SV=2
9	AFDB:O35314	0.049	0.050	1.528	675	0.159	0.164	O35314.pdb.gz	SCG1_RAT Secretogranin-1 OS=Rattus norvegicus OX=10116 GN=Chgb PE=1 SV=2
10	AFDB:Q6AI39	0.055	0.039	1.528	1079	0.137	0.089	Q6AI39.pdb.gz	BICRL_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Homo sapiens OX=9606 GN=BICRAL PE=1 SV=2
11	PDB:7aqrW	0.056	0.199	6.068	112	0.011	0.071	7aqrW.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
12	PDB:7eebD	0.055	0.135	7.829	242	0.009	0.025	7eebD.pdb.gz	Structure of a mammalian sperm cation channel complex.
13	PDB:7b93p	0.057	0.153	8.343	171	0.029	0.117	7b93p.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
14	PDB:7qsdo	0.052	0.160	9.477	122	0.026	0.148	7qsdo.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23327	0.0	1356	699	1.000	1.000	SRCH_HUMAN Sarcoplasmic reticulum histidine-rich calcium-binding protein OS=Homo sapiens OX=9606 GN=HRC PE=1 SV=1
2	Q9QZV4	2.26e-147	448	726	0.539	0.519	Q9QZV4_MOUSE Histidine-rich Ca2+ binding protein OS=Mus musculus OX=10090 GN=Hrc PE=2 SV=1
3	G5E8J6	2.40e-147	448	738	0.541	0.512	G5E8J6_MOUSE Histidine rich calcium binding protein OS=Mus musculus OX=10090 GN=Hrc PE=1 SV=1
4	Q9WVE4	2.03e-146	446	738	0.532	0.504	Q9WVE4_MOUSE Histidine-rich calcium-binding protein OS=Mus musculus OX=10090 GN=Hrc PE=2 SV=1
5	B9EIW1	7.48e-146	444	723	0.528	0.510	B9EIW1_MOUSE Hrc protein OS=Mus musculus OX=10090 GN=Hrc PE=2 SV=1
6	G3V8S6	1.13e-34	143	754	0.207	0.192	G3V8S6_RAT Histidine rich calcium binding protein OS=Rattus norvegicus OX=10116 GN=Hrc PE=1 SV=1
7	Q80W59	1.14e-34	143	755	0.207	0.192	Q80W59_RAT Histidine-rich calcium binding protein OS=Rattus norvegicus OX=10116 GN=Hrc PE=2 SV=1
8	A0A8I5ZZ96	1.24e-34	143	743	0.207	0.195	A0A8I5ZZ96_RAT Histidine rich calcium binding protein OS=Rattus norvegicus OX=10116 GN=Hrc PE=1 SV=1
9	A0A8I6AUL9	1.20e-33	139	700	0.207	0.207	A0A8I6AUL9_RAT Histidine rich calcium binding protein OS=Rattus norvegicus OX=10116 GN=Hrc PE=1 SV=1
10	A0A1B0GQY1	1.62e-18	82.4	78	0.050	0.449	A0A1B0GQY1_MOUSE Histidine rich calcium binding protein OS=Mus musculus OX=10090 GN=Hrc PE=4 SV=1
11	Q12019	4.06e-10	66.2	4910	0.124	0.018	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
12	Q6FIU8	9.95e-06	51.6	4880	0.120	0.017	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1
13	O94248	1.35e-04	48.1	4717	0.103	0.015	MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mdn1 PE=1 SV=1
14	Q54CF8	0.14	38.1	3071	0.037	0.008	Q54CF8_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293012 PE=4 SV=1
15	Q8IDX6	0.14	38.1	3130	0.049	0.011	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
16	Q8I3A0	7.2	32.3	2568	0.043	0.012	Q8I3A0_PLAF7 Copper-transporting ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0904900 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10529 Hist_rich_Ca-bd	4.9e-06	37.7	Histidine-rich Calcium-binding repeat region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252825

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000439281	0.998	Triadin
2	9606.ENSP00000440045	0.976	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
3	9606.ENSP00000349595	0.890	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
4	9606.ENSP00000353072	0.830	Sarcoplasmic/endoplasmic reticulum calcium ATPase 3
5	9606.ENSP00000221476	0.826	Creatine kinase M-type
6	9606.ENSP00000222002	0.769	Bile salt sulfotransferase
7	9606.ENSP00000377508	0.648	Junction plakoglobin
8	9606.ENSP00000326159	0.643	Kallikrein-4
9	9606.ENSP00000466775	0.642	Apolipoprotein C-II
10	9606.ENSP00000313243	0.621	Heat shock factor protein 5
11	9606.ENSP00000273183	0.601	SH3 and cysteine-rich domain-containing protein
12	9606.ENSP00000299642	0.569	C-type lectin domain family 3 member A
13	9606.ENSP00000355533	0.560	Ryanodine receptor 2
14	9606.ENSP00000248901	0.548	Cytohesin-4
15	9606.ENSP00000293373	0.535	Nck-associated protein 1-like
16	9606.ENSP00000382518	0.527	Sarcalumenin
17	9606.ENSP00000404203	0.518	Creatine kinase S-type, mitochondrial
18	9606.ENSP00000449535	0.514	Acyl-CoA synthetase short-chain family member 3, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	1.000	transmembrane transporter binding
GO:0051117	1.000	ATPase binding
GO:0005509	1.000	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0009987	0.986	cellular process
GO:0042592	0.983	homeostatic process
GO:0034762	0.976	regulation of transmembrane transport
GO:0048518	0.975	positive regulation of biological process
GO:0008016	0.971	regulation of heart contraction
GO:1904062	0.969	regulation of monoatomic cation transmembrane transport
GO:0050801	0.966	monoatomic ion homeostasis
GO:0050896	0.959	response to stimulus
GO:0055074	0.958	calcium ion homeostasis
GO:0065008	0.956	regulation of biological quality
GO:0065009	0.946	regulation of molecular function
GO:0010959	0.939	regulation of metal ion transport
GO:0051282	0.937	regulation of sequestering of calcium ion
GO:1903169	0.932	regulation of calcium ion transmembrane transport
GO:0051279	0.923	regulation of release of sequestered calcium ion into cytosol
GO:0022898	0.921	regulation of transmembrane transporter activity
GO:0032412	0.912	regulation of monoatomic ion transmembrane transporter activity
GO:0032501	0.907	multicellular organismal process
GO:0006942	0.907	regulation of striated muscle contraction
GO:0051716	0.904	cellular response to stimulus
GO:0007154	0.896	cell communication
GO:0007165	0.893	signal transduction
GO:0055117	0.881	regulation of cardiac muscle contraction
GO:0051240	0.866	positive regulation of multicellular organismal process
GO:0035556	0.859	intracellular signal transduction
GO:0003008	0.849	system process
GO:0003012	0.839	muscle system process
GO:0019222	0.803	regulation of metabolic process
GO:0080090	0.779	regulation of primary metabolic process
GO:0060255	0.776	regulation of macromolecule metabolic process
GO:0051171	0.766	regulation of nitrogen compound metabolic process
GO:0031323	0.730	regulation of cellular metabolic process
GO:1901019	0.688	regulation of calcium ion transmembrane transporter activity
GO:0010646	0.684	regulation of cell communication
GO:0030003	0.605	intracellular monoatomic cation homeostasis
GO:0006874	0.561	intracellular calcium ion homeostasis
GO:0051246	0.523	regulation of protein metabolic process
GO:0006936	0.502	muscle contraction
GO:2001257	0.496	regulation of cation channel activity
GO:0019722	0.486	calcium-mediated signaling
GO:1903524	0.478	positive regulation of blood circulation
GO:0002027	0.403	regulation of heart rate
GO:0042325	0.361	regulation of phosphorylation
GO:0031399	0.331	regulation of protein modification process
GO:0010880	0.330	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0048519	0.321	negative regulation of biological process
GO:0010882	0.307	regulation of cardiac muscle contraction by calcium ion signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016529	1.000	sarcoplasmic reticulum
GO:0016020	0.997	membrane
GO:0070013	0.997	intracellular organelle lumen
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0031090	0.988	organelle membrane
GO:0098588	0.978	bounding membrane of organelle
GO:0005789	0.974	endoplasmic reticulum membrane
GO:0033017	0.915	sarcoplasmic reticulum membrane
GO:0099080	0.846	supramolecular complex
GO:0099512	0.812	supramolecular fiber
GO:0043292	0.740	contractile fiber
GO:0030016	0.694	myofibril
GO:0005788	0.664	endoplasmic reticulum lumen
GO:0030017	0.650	sarcomere
GO:0031674	0.624	I band
GO:0030018	0.463	Z disc
GO:0005634	0.390	nucleus
GO:0033018	0.382	sarcoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]