StarFunc result for job id P23368

User Input

>input (584 residues)
MLSRLRVVSTTCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET
QDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLAC
SQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIP
VGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMK
AITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISK
PISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDS
YQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALS
NPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVIL
CNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMA
FRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23368	1.000	1.000	5.428E-104	584	1.000	1.000	P23368.pdb.gz	MAOM_HUMAN NAD-dependent malic enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1
2	AFDB:Q99KE1	0.995	0.986	7.805E-97	589	0.890	0.883	Q99KE1.pdb.gz	MAOM_MOUSE NAD-dependent malic enzyme, mitochondrial OS=Mus musculus OX=10090 GN=Me2 PE=1 SV=1
3	PDB:1gz3A	0.944	0.994	1.069E-91	554	0.943	0.995	1gz3A.pdb.gz	Molecular Mechanism for the Regulation of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme by ATP and Fumarate
4	AFDB:A0A1W2PPH1	0.918	0.982	6.811E-90	546	0.933	0.998	A0A1W2PPH1.pdb.gz	A0A1W2PPH1_HUMAN Malic enzyme OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1
5	AFDB:A0A1W2PR68	0.880	0.969	2.712E-83	530	0.906	0.998	A0A1W2PR68.pdb.gz	A0A1W2PR68_HUMAN Malic enzyme OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1
6	AFDB:Q16798	0.957	0.926	2.046E-75	604	0.541	0.523	Q16798.pdb.gz	MAON_HUMAN NADP-dependent malic enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=ME3 PE=1 SV=2
7	AFDB:P06801	0.964	0.984	9.824E-75	572	0.533	0.544	P06801.pdb.gz	MAOX_MOUSE NADP-dependent malic enzyme OS=Mus musculus OX=10090 GN=Me1 PE=1 SV=2
8	AFDB:F1N3V0	0.960	0.981	4.953E-74	571	0.533	0.545	F1N3V0.pdb.gz	F1N3V0_BOVIN Malic enzyme OS=Bos taurus OX=9913 GN=ME1 PE=3 SV=3
9	AFDB:A0A060X1Z3	0.938	0.987	9.383E-73	555	0.546	0.575	A0A060X1Z3.pdb.gz	A0A060X1Z3_ONCMY Malic enzyme OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00040244001 PE=3 SV=1
10	AFDB:A0A060XDT5	0.919	0.992	1.864E-72	541	0.551	0.595	A0A060XDT5.pdb.gz	A0A060XDT5_ONCMY Malic enzyme OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00056069001 PE=3 SV=1
11	PDB:7x11A	0.944	0.977	3.241E-71	564	0.527	0.546	7x11A.pdb.gz	Discovery and Characterization of a Novel Allosteric Small-Molecule Inhibitor of NADP + -Dependent Malic Enzyme 1.
12	AFDB:E1JIZ4	0.928	0.870	1.147E-69	624	0.519	0.486	E1JIZ4.pdb.gz	E1JIZ4_DROME Malic enzyme OS=Drosophila melanogaster OX=7227 GN=Men-b PE=1 SV=1
13	PDB:6agsA	0.887	0.929	8.869E-54	557	0.384	0.402	6agsA.pdb.gz
14	PDB:6urfD	0.822	0.908	1.480E-39	526	0.317	0.352	6urfD.pdb.gz
15	PDB:6urfC	0.792	0.906	9.189E-31	507	0.315	0.363	6urfC.pdb.gz
16	PDB:3h9uC	0.237	0.296	1.809E-4	435	0.116	0.156	3h9uC.pdb.gz	Crystal structure of S-adenosyl homocysteine hydrolase (SAHH) from Trypanosoma brucei
17	PDB:3ce6A	0.203	0.236	3.258E-4	486	0.106	0.128	3ce6A.pdb.gz	Crystal structures of Mycobacterium tuberculosis S-adenosyl-L-homocysteine hydrolase in ternary complex with substrate and inhibitors.
18	PDB:1a7aA	0.211	0.268	1.643E-3	431	0.110	0.148	1a7aA.pdb.gz	Structure determination of selenomethionyl S-adenosylhomocysteine hydrolase using data at a single wavelength.
19	PDB:7f79C	0.246	0.295	2.958E-3	458	0.087	0.111	7f79C.pdb.gz	Crystal structure of glutamate dehydrogenase 3 from Candida albicans.
20	PDB:7f77A	0.269	0.335	3.427E-3	430	0.099	0.135	7f77A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060X1Z3	660	555	0.545	0.573	A0A060X1Z3_ONCMY Malic enzyme OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00040244001 PE=3 SV=1
2	A0A060XDT5	692	541	0.553	0.597	A0A060XDT5_ONCMY Malic enzyme OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00056069001 PE=3 SV=1
3	A0A1W2PPH1	1118	546	0.935	1.000	A0A1W2PPH1_HUMAN Malic enzyme OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1
4	A0A1W2PQH3	1135	547	0.937	1.000	A0A1W2PQH3_HUMAN Malic enzyme OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1
5	A0A1W2PQT3	1095	536	0.906	0.987	A0A1W2PQT3_HUMAN Malic enzyme OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1
6	A0A1W2PQY8	1098	565	0.908	0.938	A0A1W2PQY8_HUMAN Malic enzyme OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1
7	A0A1W2PR68	1043	530	0.889	0.979	A0A1W2PR68_HUMAN Malic enzyme OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1
8	E1JIZ4	623	624	0.510	0.478	E1JIZ4_DROME Malic enzyme OS=Drosophila melanogaster OX=7227 GN=Men-b PE=1 SV=1
9	F1N3V0	676	571	0.534	0.546	F1N3V0_BOVIN Malic enzyme OS=Bos taurus OX=9913 GN=ME1 PE=3 SV=3
10	O82191	565	581	0.469	0.472	MAOP1_ARATH NADP-dependent malic enzyme 1 OS=Arabidopsis thaliana OX=3702 GN=NADP-ME1 PE=1 SV=1
11	P06801	676	572	0.534	0.545	MAOX_MOUSE NADP-dependent malic enzyme OS=Mus musculus OX=10090 GN=Me1 PE=1 SV=2
12	P13697	681	572	0.539	0.551	MAOX_RAT NADP-dependent malic enzyme OS=Rattus norvegicus OX=10116 GN=Me1 PE=1 SV=2
13	P23368	1214	584	1.000	1.000	MAOM_HUMAN NAD-dependent malic enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1
14	P48163	677	572	0.533	0.544	MAOX_HUMAN NADP-dependent malic enzyme OS=Homo sapiens OX=9606 GN=ME1 PE=1 SV=1
15	Q16798	676	604	0.538	0.520	MAON_HUMAN NADP-dependent malic enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=ME3 PE=1 SV=2
16	Q2QBM1	577	578	0.478	0.483	Q2QBM1_DROME Malic enzyme OS=Drosophila melanogaster OX=7227 GN=Men PE=1 SV=1
17	Q8BMF3	686	604	0.545	0.526	MAON_MOUSE NADP-dependent malic enzyme, mitochondrial OS=Mus musculus OX=10090 GN=Me3 PE=1 SV=2
18	Q99KE1	1097	589	0.890	0.883	MAOM_MOUSE NAD-dependent malic enzyme, mitochondrial OS=Mus musculus OX=10090 GN=Me2 PE=1 SV=1
19	Q9CA83	555	646	0.454	0.410	MAOP4_ARATH NADP-dependent malic enzyme 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NADP-ME4 PE=1 SV=1
20	Q9LYG3	570	588	0.471	0.468	MAOP2_ARATH NADP-dependent malic enzyme 2 OS=Arabidopsis thaliana OX=3702 GN=NADP-ME2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00390 malic	3.3e-75	263.4	Malic enzyme, N-terminal domain
2	PF03949 Malic_M	7.4e-94	325.4	Malic enzyme, NAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321070

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000445175	0.971	Lactate dehydrogenase A
2	9606.ENSP00000327070	0.966	Malate dehydrogenase, mitochondrial
3	9606.ENSP00000377532	0.956	Pyruvate carboxylase, mitochondrial
4	9606.ENSP00000438144	0.953	Malate dehydrogenase, cytoplasmic
5	9606.ENSP00000355518	0.952	Fumarate hydratase, mitochondrial
6	9606.ENSP00000339933	0.946	Pyruvate kinase PKLR
7	9606.ENSP00000320171	0.944	Pyruvate kinase PKM
8	9606.ENSP00000379386	0.936	Lactate dehydrogenase B
9	9606.ENSP00000307241	0.924	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
10	9606.ENSP00000280706	0.923	L-lactate dehydrogenase A-like 6A
11	9606.ENSP00000302393	0.923	Lactate dehydrogenase A like 6B
12	9606.ENSP00000437783	0.923	L-lactate dehydrogenase C chain
13	9606.ENSP00000295266	0.922	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
14	9606.ENSP00000300051	0.903	Probable D-lactate dehydrogenase, mitochondrial
15	9606.ENSP00000342056	0.879	Citrate synthase, mitochondrial
16	9606.ENSP00000482410	0.813	Jerky protein homolog
17	9606.ENSP00000440246	0.809	NADP-dependent malic enzyme, mitochondrial
18	9606.ENSP00000358719	0.808	Malic enzyme 1
19	9606.ENSP00000328938	0.804	Kynurenine formamidase
20	9606.ENSP00000362271	0.687	Adenylate kinase isoenzyme 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016616	1.000	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0004470	1.000	malic enzyme activity
GO:0009055	0.992	electron transfer activity
GO:0005488	0.925	binding
GO:0004473	0.767	malate dehydrogenase (decarboxylating) (NADP+) activity
GO:1901363	0.668	heterocyclic compound binding
GO:0097159	0.668	organic cyclic compound binding
GO:0043167	0.513	ion binding
GO:0036094	0.397	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.978	organic substance metabolic process
GO:0044237	0.975	cellular metabolic process
GO:0044281	0.937	small molecule metabolic process
GO:0050794	0.826	regulation of cellular process
GO:0019752	0.748	carboxylic acid metabolic process
GO:0019222	0.747	regulation of metabolic process
GO:0031323	0.601	regulation of cellular metabolic process
GO:0080090	0.471	regulation of primary metabolic process
GO:0062012	0.464	regulation of small molecule metabolic process
GO:0051174	0.362	regulation of phosphorus metabolic process
GO:0032787	0.328	monocarboxylic acid metabolic process
GO:0044238	0.302	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0005759	0.924	mitochondrial matrix
GO:0005634	0.441	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.-	1.000	With NAD(+) or NADP(+) as acceptor.
RHEA:18253	0.767	(S)-malate + NADP(+) = CO2 + NADPH + pyruvate
EC:1.1.1.40	0.767	malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+)).

[back to server]