StarFunc result for job id P23378

User Input

>input (1020 residues)
MQSCARAWGLRLGRGVGGGRRLAGGSGPCWAPRSRDSSSGGGDSAAAGASRLLERLLPRH
DDFARRHIGPGDKDQREMLQTLGLASIDELIEKTVPANIRLKRPLKMEDPVCENEILATL
HAISSKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWITQYTPYQPEVSQGRLESLLNYQ
TMVCDITGLDMANASLLDEGTAAAEALQLCYRHNKRRKFLVDPRCHPQTIAVVQTRAKYT
GVLTELKLPCEMDFSGKDVSGVLFQYPDTEGKVEDFTELVERAHQSGSLACCATDLLALC
ILRPPGEFGVDIALGSSQRFGVPLGYGGPHAAFFAVRESLVRMMPGRMVGVTRDATGKEV
YRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLEHIARRVHNATLILSE
GLKRAGHQLQHDLFFDTLKIQCGCSVKEVLGRAAQRQINFRLFEDGTLGISLDETVNEKD
LDDLLWIFGCESSAELVAESMGEECRGIPGSVFKRTSPFLTHQVFNSYHSETNIVRYMKK
LENKDISLVHSMIPLGSCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEK
DLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHM
AGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQH
GGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFL
PNHPVISLKRNEDACPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYM
AKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVA
GTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHW
DRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6i33B	0.905	0.998	0.000	925	0.906	0.999	6i33B.pdb.gz	Structural insights in human glycine decarboxylase and comparison with the Neanderthal variant
2	PDB:6i34B	0.935	0.999	0.000	954	0.933	0.998	6i34B.pdb.gz	Structural insights in human glycine decarboxylase and comparison with the Neanderthal variant
3	AFDB:A0A0G2JUZ5	0.923	0.998	0.000	943	0.863	0.933	A0A0G2JUZ5.pdb.gz	A0A0G2JUZ5_RAT Glycine cleavage system P protein OS=Rattus norvegicus OX=10116 GN=Gldc PE=1 SV=2
4	AFDB:D4A5Q9	0.813	0.937	0.000	884	0.798	0.921	D4A5Q9.pdb.gz	D4A5Q9_RAT Glycine decarboxylase OS=Rattus norvegicus OX=10116 GN=Gldc PE=4 SV=1
5	AFDB:O80988	0.922	0.901	0.000	1044	0.539	0.527	O80988.pdb.gz	GCSP2_ARATH Glycine dehydrogenase (decarboxylating) 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLDP2 PE=1 SV=1
6	AFDB:P15505	0.943	0.958	0.000	1004	0.820	0.833	P15505.pdb.gz	GCSP_CHICK Glycine dehydrogenase (decarboxylating), mitochondrial OS=Gallus gallus OX=9031 GN=GLDC PE=1 SV=2
7	AFDB:P26969	0.924	0.892	0.000	1057	0.530	0.512	P26969.pdb.gz	GCSP_PEA Glycine dehydrogenase (decarboxylating), mitochondrial OS=Pisum sativum OX=3888 GN=GDCSP PE=1 SV=1
8	AFDB:P33195	0.918	0.978	0.000	957	0.501	0.534	P33195.pdb.gz	GCSP_ECOLI Glycine dehydrogenase (decarboxylating) OS=Escherichia coli (strain K12) OX=83333 GN=gcvP PE=1 SV=3
9	AFDB:P49095	0.909	0.897	0.000	1034	0.505	0.498	P49095.pdb.gz	GCSP_YEAST Glycine dehydrogenase (decarboxylating), mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCV2 PE=1 SV=1
10	AFDB:P9WN53	0.893	0.968	0.000	941	0.473	0.512	P9WN53.pdb.gz	GCSP_MYCTU Probable glycine dehydrogenase (decarboxylating) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=gcvP PE=1 SV=1
11	AFDB:Q09785	0.921	0.912	0.000	1031	0.495	0.490	Q09785.pdb.gz	GCSP_SCHPO Putative glycine dehydrogenase (decarboxylating), mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcv2 PE=3 SV=2
12	AFDB:Q57V19	0.921	0.968	0.000	970	0.467	0.491	Q57V19.pdb.gz	Q57V19_TRYB2 Glycine cleavage system P protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.43M14.350 PE=3 SV=1
13	PDB:3f9tA	0.309	0.735	1.177E-13	394	0.061	0.157	3f9tA.pdb.gz	Crystal structure of L-tyrosine decarboxylase MfnA (EC 4.1.1.25) (NP_247014.1) from METHANOCOCCUS JANNASCHII at 2.11 A resolution
14	PDB:1dfoB	0.303	0.690	5.050E-12	417	0.072	0.175	1dfoB.pdb.gz	Crystal structure at 2.4 A resolution of E. coli serine hydroxymethyltransferase in complex with glycine substrate and 5-formyl tetrahydrofolate.
15	PDB:6o11A	0.293	0.683	5.310E-12	406	0.067	0.167	6o11A.pdb.gz	Direct observation of intermediates in the SufS cysteine desulfurase reaction reveals functional roles of conserved active-site residues.
16	PDB:5eudA	0.237	0.496	5.870E-12	454	0.070	0.156	5eudA.pdb.gz	Creation of a S1P Lyase bacterial surrogate for structure-based drug design.
17	PDB:3hbxA	0.286	0.624	1.309E-11	437	0.056	0.130	3hbxA.pdb.gz
18	PDB:3caiA	0.270	0.636	1.447E-11	396	0.054	0.139	3caiA.pdb.gz
19	PDB:5x6bJ	0.260	0.648	4.145E-11	377	0.041	0.111	5x6bJ.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis
20	PDB:4wydA	0.242	0.527	1.022E-10	430	0.055	0.130	4wydA.pdb.gz	Fragment-Based Exploration of Binding Site Flexibility in Mycobacterium tuberculosis BioA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUZ5	0.0	1911	1029	0.923	0.914	A0A0G2JUZ5_RAT Glycine cleavage system P protein OS=Rattus norvegicus OX=10116 GN=Gldc PE=1 SV=2
2	A0A8I6AP64	0.0	1668	883	0.790	0.913	A0A8I6AP64_RAT Glycine cleavage system P protein OS=Rattus norvegicus OX=10116 GN=Gldc PE=1 SV=1
3	A0A8I6AWV3	0.0	1794	931	0.852	0.933	A0A8I6AWV3_RAT Glycine cleavage system P protein OS=Rattus norvegicus OX=10116 GN=Gldc PE=1 SV=1
4	D4A5Q9	0.0	1278	884	0.624	0.719	D4A5Q9_RAT Glycine decarboxylase OS=Rattus norvegicus OX=10116 GN=Gldc PE=4 SV=1
5	O80988	0.0	1107	1044	0.530	0.518	GCSP2_ARATH Glycine dehydrogenase (decarboxylating) 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLDP2 PE=1 SV=1
6	P15505	0.0	1748	1004	0.822	0.835	GCSP_CHICK Glycine dehydrogenase (decarboxylating), mitochondrial OS=Gallus gallus OX=9031 GN=GLDC PE=1 SV=2
7	P23378	0.0	2132	1020	1.000	1.000	GCSP_HUMAN Glycine dehydrogenase (decarboxylating), mitochondrial OS=Homo sapiens OX=9606 GN=GLDC PE=1 SV=2
8	P26969	0.0	1090	1057	0.528	0.510	GCSP_PEA Glycine dehydrogenase (decarboxylating), mitochondrial OS=Pisum sativum OX=3888 GN=GDCSP PE=1 SV=1
9	P33195	0.0	977	957	0.499	0.532	GCSP_ECOLI Glycine dehydrogenase (decarboxylating) OS=Escherichia coli (strain K12) OX=83333 GN=gcvP PE=1 SV=3
10	P49095	0.0	1011	1034	0.503	0.496	GCSP_YEAST Glycine dehydrogenase (decarboxylating), mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCV2 PE=1 SV=1
11	P9WN53	0.0	915	941	0.472	0.511	GCSP_MYCTU Probable glycine dehydrogenase (decarboxylating) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=gcvP PE=1 SV=1
12	Q09785	0.0	1008	1031	0.494	0.489	GCSP_SCHPO Putative glycine dehydrogenase (decarboxylating), mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcv2 PE=3 SV=2
13	Q57V19	0.0	955	970	0.466	0.490	Q57V19_TRYB2 Glycine cleavage system P protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.43M14.350 PE=3 SV=1
14	Q91W43	0.0	1880	1025	0.919	0.914	GCSP_MOUSE Glycine dehydrogenase (decarboxylating), mitochondrial OS=Mus musculus OX=10090 GN=Gldc PE=1 SV=1
15	Q94B78	0.0	1096	1037	0.530	0.522	GCSP1_ARATH Glycine dehydrogenase (decarboxylating) 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLDP1 PE=1 SV=2
16	Q72C60	1.28e-62	223	481	0.162	0.343	Q72C60_DESVH glycine dehydrogenase (aminomethyl-transferring) OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=gcvPB PE=1 SV=1
17	Q72C59	1.98e-56	204	443	0.133	0.307	GCSPA_DESVH Probable glycine dehydrogenase (decarboxylating) subunit 1 OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=gcvPA PE=1 SV=1
18	O58679	0.036	40.0	383	0.060	0.159	MFNA_PYRHO L-aspartate/L-glutamate decarboxylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=mfnA PE=1 SV=1
19	Q8R0X7	0.12	38.5	568	0.071	0.127	SGPL1_MOUSE Sphingosine-1-phosphate lyase 1 OS=Mus musculus OX=10090 GN=Sgpl1 PE=1 SV=1
20	Q5JJ82	0.48	36.6	384	0.060	0.159	MFNA_THEKO L-aspartate decarboxylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=mfnA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	4.8e+02	11.3	Aminotransferase class I and II
2	PF00266 Aminotran_5	1.1	19.8	Aminotransferase class-V
3	PF01212 Beta_elim_lyase	4.1e-06	37.9	Beta-eliminating lyase
4	PF02347 GDC-P	1.8e-208	704.3	Glycine cleavage system P-protein
5	PF00282 Pyridoxal_deC	2.3e+02	11.9	Pyridoxal-dependent decarboxylase conserved domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370737

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000273588	0.999	Aminomethyltransferase, mitochondrial
2	9606.ENSP00000319531	0.999	Glycine cleavage system H protein, mitochondrial
3	9606.ENSP00000318868	0.991	Serine hydroxymethyltransferase, cytosolic
4	9606.ENSP00000333667	0.991	Serine hydroxymethyltransferase, mitochondrial
5	9606.ENSP00000205402	0.987	Dihydrolipoyl dehydrogenase, mitochondrial
6	9606.ENSP00000360938	0.982	Sarcosine dehydrogenase, mitochondrial
7	9606.ENSP00000302620	0.967	Alanine-glyoxylate aminotransferase
8	9606.ENSP00000231420	0.966	Alanine--glyoxylate aminotransferase 2, mitochondrial
9	9606.ENSP00000317721	0.943	Peroxisomal sarcosine oxidase
10	9606.ENSP00000361894	0.937	Glycine N-methyltransferase
11	9606.ENSP00000228476	0.936	D-amino-acid oxidase
12	9606.ENSP00000310447	0.936	Glutaminase liver isoform, mitochondrial
13	9606.ENSP00000379895	0.925	Glycine amidinotransferase, mitochondrial
14	9606.ENSP00000378416	0.921	5-aminolevulinate synthase, nonspecific, mitochondrial
15	9606.ENSP00000332369	0.917	5-aminolevulinate synthase, erythroid-specific, mitochondrial
16	9606.ENSP00000307900	0.904	Glutamine synthetase
17	9606.ENSP00000255416	0.894	Myosin-binding protein H
18	9606.ENSP00000317379	0.890	Glutaminase kidney isoform, mitochondrial
19	9606.ENSP00000364490	0.881	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
20	9606.ENSP00000277865	0.866	Glutamate dehydrogenase 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004375	1.000	glycine dehydrogenase (decarboxylating) activity
GO:0070279	1.000	vitamin B6 binding
GO:0005515	0.999	protein binding
GO:0016594	0.997	glycine binding
GO:0030170	0.994	pyridoxal phosphate binding
GO:0019899	0.988	enzyme binding
GO:0009055	0.602	electron transfer activity
GO:0042802	0.385	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.999	cellular metabolic process
GO:0044238	0.998	primary metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0044281	0.996	small molecule metabolic process
GO:1901606	0.986	alpha-amino acid catabolic process
GO:0006544	0.985	glycine metabolic process
GO:0009071	0.983	serine family amino acid catabolic process
GO:0006546	0.432	glycine catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.938	intracellular organelle lumen
GO:0032991	0.574	protein-containing complex
GO:1902494	0.501	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24304	1.000	(R)-N(6)-lipoyl-L-lysyl-[glycine-cleavage complex H protein] + glycine + H(+) = (R)-N(6)-(S(8)-aminomethyldihydrolipoyl)-L-lysyl-[glycine-cleavage complex H protein] + CO2
EC:1.4.4.2	1.000	glycine dehydrogenase (aminomethyl-transferring).

[back to server]