StarFunc result for job id P23409

User Input

>input (242 residues)
MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEE
HVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRT
VANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFL
RTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVV
EK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15375	0.629	0.629	2.589E-34	242	0.955	0.955	P15375.pdb.gz	MYF6_MOUSE Myogenic factor 6 OS=Mus musculus OX=10090 GN=Myf6 PE=2 SV=1
2	AFDB:Q01795	0.597	0.597	2.386E-31	242	0.855	0.855	Q01795.pdb.gz	MYF6_CHICK Myogenic factor 6 OS=Gallus gallus OX=9031 GN=MYF6 PE=2 SV=1
3	AFDB:Q6VNZ9	0.328	0.331	1.390E-21	239	0.628	0.636	Q6VNZ9.pdb.gz	MYF6_DANRE Myogenic factor 6 OS=Danio rerio OX=7955 GN=myf6 PE=2 SV=1
4	AFDB:B0S6I5	0.347	0.329	1.104E-15	256	0.430	0.406	B0S6I5.pdb.gz
5	AFDB:C4P6Q3	0.354	0.376	3.584E-14	227	0.455	0.485	C4P6Q3.pdb.gz	C4P6Q3_CHICK Myogenin OS=Gallus gallus OX=9031 GN=MYOG PE=2 SV=1
6	AFDB:P12979	0.324	0.346	3.262E-13	224	0.438	0.473	P12979.pdb.gz	MYOG_MOUSE Myogenin OS=Mus musculus OX=10090 GN=Myog PE=1 SV=2
7	AFDB:Q5CZP8	0.330	0.336	5.957E-13	237	0.376	0.384	Q5CZP8.pdb.gz
8	AFDB:P13349	0.367	0.349	1.163E-12	255	0.376	0.357	P13349.pdb.gz	MYF5_HUMAN Myogenic factor 5 OS=Homo sapiens OX=9606 GN=MYF5 PE=1 SV=2
9	AFDB:P24699	0.356	0.340	2.597E-12	255	0.393	0.373	P24699.pdb.gz	MYF5_MOUSE Myogenic factor 5 OS=Mus musculus OX=10090 GN=Myf5 PE=1 SV=1
10	AFDB:Q08856	0.345	0.326	2.597E-12	258	0.434	0.407	Q08856.pdb.gz	MYF5_CHICK Myogenic factor 5 OS=Gallus gallus OX=9031 GN=MYF5 PE=3 SV=2
11	PDB:5u6yA	0.077	0.048	1.552	459	0.062	0.033	5u6yA.pdb.gz
12	PDB:6wg3C	0.139	0.136	2.320	248	0.070	0.069	6wg3C.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
13	PDB:5n9jG	0.086	0.115	2.480	163	0.112	0.166	5n9jG.pdb.gz
14	PDB:4v6wCh	0.142	0.258	3.032	123	0.062	0.122	4v6wCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:2bskD	0.142	0.323	3.706	90	0.079	0.211	2bskD.pdb.gz
16	PDB:6k15J	0.114	0.117	3.962	235	0.074	0.077	6k15J.pdb.gz	Structure of the RSC complex bound to the nucleosome.
17	PDB:7a5fR3	0.179	0.270	4.529	140	0.083	0.143	7a5fR3.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
18	PDB:6lo8E	0.159	0.416	4.843	80	0.037	0.113	6lo8E.pdb.gz
19	PDB:6tuyA	0.159	0.064	4.843	667	0.066	0.024	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
20	PDB:3jb9W	0.141	0.088	5.178	426	0.070	0.040	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23409	0.0	498	242	1.000	1.000	MYF6_HUMAN Myogenic factor 6 OS=Homo sapiens OX=9606 GN=MYF6 PE=1 SV=1
2	P15375	3.16e-172	475	242	0.955	0.955	MYF6_MOUSE Myogenic factor 6 OS=Mus musculus OX=10090 GN=Myf6 PE=2 SV=1
3	P19335	8.00e-165	456	242	0.955	0.955	MYF6_RAT Myogenic factor 6 OS=Rattus norvegicus OX=10116 GN=Myf6 PE=1 SV=1
4	Q01795	1.47e-141	398	242	0.855	0.855	MYF6_CHICK Myogenic factor 6 OS=Gallus gallus OX=9031 GN=MYF6 PE=2 SV=1
5	Q6VNZ9	1.27e-86	258	239	0.628	0.636	MYF6_DANRE Myogenic factor 6 OS=Danio rerio OX=7955 GN=myf6 PE=2 SV=1
6	Q9DG26	2.02e-51	169	256	0.459	0.434	Q9DG26_DANRE Myogenin OS=Danio rerio OX=7955 GN=zgc:100763 PE=2 SV=1
7	P15173	2.00e-50	166	224	0.459	0.496	MYOG_HUMAN Myogenin OS=Homo sapiens OX=9606 GN=MYOG PE=1 SV=2
8	P12979	5.30e-50	165	224	0.471	0.509	MYOG_MOUSE Myogenin OS=Mus musculus OX=10090 GN=Myog PE=1 SV=2
9	C4P6Q3	8.11e-48	159	227	0.442	0.471	C4P6Q3_CHICK Myogenin OS=Gallus gallus OX=9031 GN=MYOG PE=2 SV=1
10	P17920	8.11e-48	159	227	0.442	0.471	MYOG_CHICK Myogenin OS=Gallus gallus OX=9031 GN=MYOG PE=2 SV=1
11	P20428	1.26e-44	153	287	0.397	0.334	MYOG_RAT Myogenin OS=Rattus norvegicus OX=10116 GN=Myog PE=1 SV=1
12	P24699	2.36e-43	149	255	0.380	0.361	MYF5_MOUSE Myogenic factor 5 OS=Mus musculus OX=10090 GN=Myf5 PE=1 SV=1
13	Q08856	5.79e-43	148	258	0.397	0.372	MYF5_CHICK Myogenic factor 5 OS=Gallus gallus OX=9031 GN=MYF5 PE=3 SV=2
14	Q9DDW0	5.80e-42	144	237	0.347	0.354	Q9DDW0_DANRE Myogenic factor OS=Danio rerio OX=7955 GN=myf-5 PE=2 SV=1
15	P13349	1.20e-41	144	255	0.372	0.353	MYF5_HUMAN Myogenic factor 5 OS=Homo sapiens OX=9606 GN=MYF5 PE=1 SV=2
16	Q90477	7.05e-40	140	275	0.360	0.316	MYOD1_DANRE Myoblast determination protein 1 homolog OS=Danio rerio OX=7955 GN=myod1 PE=1 SV=2
17	P13904	2.26e-38	137	289	0.364	0.304	MYODA_XENLA Myoblast determination protein 1 homolog A OS=Xenopus laevis OX=8355 GN=myod1-a PE=2 SV=1
18	P16075	3.23e-37	134	298	0.397	0.322	MYOD1_CHICK Myoblast determination protein 1 homolog OS=Gallus gallus OX=9031 GN=MYOD1 PE=2 SV=2
19	P22816	5.00e-37	134	332	0.285	0.208	MYOD_DROME Myogenic-determination protein OS=Drosophila melanogaster OX=7227 GN=nau PE=2 SV=3
20	Q02346	2.11e-35	130	318	0.360	0.274	MYOD1_RAT Myoblast determination protein 1 OS=Rattus norvegicus OX=10116 GN=Myod1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01586 Basic	2.3e-20	84.8	Myogenic Basic domain
2	PF00010 HLH	2.7e-09	48.2	Helix-loop-helix DNA-binding domain
3	PF12232 Myf5	7.6	18.7	Myogenic determination factor 5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228641

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000388940	0.936	Transcription factor 12
2	9606.ENSP00000262965	0.912	Transcription factor E2-alpha
3	9606.ENSP00000271555	0.879	Myocyte-specific enhancer factor 2D
4	9606.ENSP00000381382	0.858	Transcription factor 4
5	9606.ENSP00000346389	0.853	Myocyte-specific enhancer factor 2A
6	9606.ENSP00000364524	0.843	Paired box protein Pax-7
7	9606.ENSP00000340874	0.826	Myocyte-specific enhancer factor 2C
8	9606.ENSP00000375921	0.784	Paired box protein Pax-3
9	9606.ENSP00000228644	0.782	Myogenic factor 5
10	9606.ENSP00000423820	0.770	Zinc finger protein 62 homolog
11	9606.ENSP00000250003	0.765	Myoblast determination protein 1
12	9606.ENSP00000229795	0.740	Mitogen-activated protein kinase 14
13	9606.ENSP00000260950	0.730	Growth/differentiation factor 8
14	9606.ENSP00000241651	0.720	Myogenin
15	9606.ENSP00000215659	0.703	Mitogen-activated protein kinase 12
16	9606.ENSP00000386041	0.685	Myosin-6
17	9606.ENSP00000245503	0.680	Myosin-2
18	9606.ENSP00000333685	0.679	Mitogen-activated protein kinase 11
19	9606.ENSP00000226207	0.665	Myosin-1
20	9606.ENSP00000428205	0.652	F-box only protein 32

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000977	0.986	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.978	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0043425	0.919	bHLH transcription factor binding
GO:0000978	0.916	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.906	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0070888	0.838	E-box binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0048856	0.994	anatomical structure development
GO:0050794	0.991	regulation of cellular process
GO:0019222	0.987	regulation of metabolic process
GO:0061061	0.982	muscle structure development
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0080090	0.969	regulation of primary metabolic process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0009987	0.966	cellular process
GO:0031323	0.966	regulation of cellular metabolic process
GO:0010468	0.961	regulation of gene expression
GO:0019219	0.960	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.945	regulation of biosynthetic process
GO:0051252	0.934	regulation of RNA metabolic process
GO:0031326	0.930	regulation of cellular biosynthetic process
GO:0010556	0.928	regulation of macromolecule biosynthetic process
GO:0007517	0.922	muscle organ development
GO:0006355	0.918	regulation of DNA-templated transcription
GO:0048518	0.822	positive regulation of biological process
GO:0060537	0.754	muscle tissue development
GO:0048522	0.752	positive regulation of cellular process
GO:0060538	0.746	skeletal muscle organ development
GO:0006357	0.694	regulation of transcription by RNA polymerase II
GO:0007519	0.691	skeletal muscle tissue development
GO:0048869	0.630	cellular developmental process
GO:0030154	0.590	cell differentiation
GO:0031325	0.466	positive regulation of cellular metabolic process
GO:0010604	0.460	positive regulation of macromolecule metabolic process
GO:0045935	0.456	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.449	positive regulation of RNA metabolic process
GO:0045893	0.439	positive regulation of DNA-templated transcription
GO:0032501	0.366	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.663	cytoplasm
GO:0032991	0.655	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]