StarFunc result for job id P23415

User Input

>input (457 residues)
MYSFNTLRLYLWETIVFFSLAASKEAEAARSAPKPMSPSDFLDKLMGRTSGYDARIRPNF
KGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYPDDSLDLDPSMLDS
IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTC
IMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIEA
RFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRA
SLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKSPMLNLF
QEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRA
KKIDKISRIGFPMAFLIFNMFYWIIYKIVRREDVHNQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07727	0.994	0.994	1.358E-82	457	0.985	0.985	P07727.pdb.gz	GLRA1_RAT Glycine receptor subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Glra1 PE=1 SV=4
2	AFDB:O75311	0.842	0.829	3.233E-73	464	0.816	0.804	O75311.pdb.gz	GLRA3_HUMAN Glycine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=GLRA3 PE=1 SV=2
3	AFDB:O93430	0.853	0.878	5.884E-71	444	0.829	0.854	O93430.pdb.gz	GLRA1_DANRE Glycine receptor subunit alphaZ1 OS=Danio rerio OX=7955 GN=glra1 PE=1 SV=1
4	AFDB:B3DJL8	0.861	0.875	6.506E-69	450	0.790	0.802	B3DJL8.pdb.gz
5	AFDB:P22771	0.826	0.835	2.128E-67	452	0.737	0.746	P22771.pdb.gz	GLRA2_RAT Glycine receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Glra2 PE=1 SV=1
6	AFDB:Q61603	0.837	0.839	1.184E-66	456	0.718	0.719	Q61603.pdb.gz	GLRA4_MOUSE Glycine receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Glra4 PE=1 SV=3
7	AFDB:F1Q832	0.819	0.815	1.251E-66	459	0.724	0.721	F1Q832.pdb.gz
8	AFDB:Q5U3C8	0.808	0.696	1.597E-65	532	0.696	0.598	Q5U3C8.pdb.gz	Q5U3C8_DANRE Glra4b protein (Fragment) OS=Danio rerio OX=7955 GN=glra4b PE=2 SV=1
9	AFDB:A0A2R8QMY9	0.826	0.821	3.546E-64	460	0.694	0.689	A0A2R8QMY9.pdb.gz
10	AFDB:F1Q835	0.801	0.884	8.322E-63	413	0.678	0.751	F1Q835.pdb.gz
11	PDB:6i53B	0.693	0.932	7.755E-39	338	0.333	0.450	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:6i53A	0.683	0.891	2.480E-38	349	0.322	0.421	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:7kuyE	0.662	0.882	1.380E-37	338	0.400	0.541	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
14	PDB:4hfcA	0.610	0.880	5.297E-24	311	0.155	0.228	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:7l6qA	0.493	0.705	3.299E-18	311	0.149	0.219	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
16	PDB:6zgdA	0.538	0.828	6.706E-16	288	0.151	0.240	6zgdA.pdb.gz
17	PDB:4afhA	0.360	0.718	1.319E-12	213	0.068	0.146	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
18	PDB:2w8gC	0.363	0.723	2.564E-12	217	0.061	0.129	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
19	PDB:4aq5E	0.515	0.625	4.219E-12	370	0.131	0.162	4aq5E.pdb.gz
20	PDB:5nzuD	0.095	0.099	4.050E-4	427	0.081	0.087	5nzuD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D1KZ66	0.0	663	448	0.691	0.705	D1KZ66_DANRE Glycine receptor alpha 2 subunit OS=Danio rerio OX=7955 GN=glra2 PE=2 SV=1
2	F1R8P4	0.0	667	449	0.707	0.719	GLRA2_DANRE Glycine receptor subunit alpha-2 OS=Danio rerio OX=7955 GN=glra2 PE=3 SV=2
3	F1RDZ6	0.0	686	457	0.740	0.740	F1RDZ6_DANRE Glycine receptor subunit alpha-4 isoform X1 OS=Danio rerio OX=7955 GN=[a]Z2 PE=3 SV=1
4	O75311	0.0	775	464	0.812	0.800	GLRA3_HUMAN Glycine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=GLRA3 PE=1 SV=2
5	O93430	0.0	796	444	0.840	0.865	GLRA1_DANRE Glycine receptor subunit alphaZ1 OS=Danio rerio OX=7955 GN=glra1 PE=1 SV=1
6	P07727	0.0	946	457	0.985	0.985	GLRA1_RAT Glycine receptor subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Glra1 PE=1 SV=4
7	P22771	0.0	701	452	0.740	0.748	GLRA2_RAT Glycine receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Glra2 PE=1 SV=1
8	P23415	0.0	957	457	1.000	1.000	GLRA1_HUMAN Glycine receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=GLRA1 PE=1 SV=2
9	P23416	0.0	703	452	0.742	0.750	GLRA2_HUMAN Glycine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=GLRA2 PE=1 SV=1
10	P24524	0.0	770	464	0.807	0.795	GLRA3_RAT Glycine receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Glra3 PE=1 SV=1
11	Q5U3C8	0.0	657	532	0.702	0.603	Q5U3C8_DANRE Glra4b protein (Fragment) OS=Danio rerio OX=7955 GN=glra4b PE=2 SV=1
12	Q61603	0.0	694	456	0.746	0.748	GLRA4_MOUSE Glycine receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Glra4 PE=1 SV=3
13	Q64018	0.0	949	457	0.989	0.989	GLRA1_MOUSE Glycine receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Glra1 PE=1 SV=2
14	Q7TNC8	0.0	703	452	0.742	0.750	GLRA2_MOUSE Glycine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Glra2 PE=1 SV=1
15	Q90W14	0.0	735	450	0.790	0.802	Q90W14_DANRE Glycine receptor alphaZ3 subunit OS=Danio rerio OX=7955 GN=glyRalpha3 PE=2 SV=1
16	Q91XP5	0.0	775	464	0.812	0.800	GLRA3_MOUSE Glycine receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Glra3 PE=1 SV=2
17	Q9DES9	0.0	678	456	0.731	0.732	Q9DES9_DANRE Glycine receptor alphaZ2 subunit OS=Danio rerio OX=7955 GN=glyR alpha PE=2 SV=1
18	Q6DC22	1.45e-122	368	494	0.462	0.427	Q6DC22_DANRE Glycine receptor beta subunit 2 OS=Danio rerio OX=7955 GN=glrb2 PE=1 SV=1
19	P48167	5.14e-122	366	497	0.457	0.421	GLRB_HUMAN Glycine receptor subunit beta OS=Homo sapiens OX=9606 GN=GLRB PE=1 SV=1
20	P20781	1.51e-120	362	496	0.460	0.423	GLRB_RAT Glycine receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Glrb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	3.8e-49	178.6	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	5.1e-37	139.8	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000411593

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417901	0.921	Gephyrin
2	9606.ENSP00000373918	0.849	Glycine--tRNA ligase
3	9606.ENSP00000434364	0.820	Sodium- and chloride-dependent glycine transporter 2
4	9606.ENSP00000361700	0.809	Glycine receptor subunit alpha-4
5	9606.ENSP00000288699	0.732	Dihydropyrimidinase-related protein 5
6	9606.ENSP00000385158	0.687	Protein FAM161A
7	9606.ENSP00000384264	0.669	cGMP-gated cation channel alpha-1
8	9606.ENSP00000384004	0.668	POU domain, class 6, transcription factor 2
9	9606.ENSP00000468348	0.646	Dual specificity mitogen-activated protein kinase kinase 6
10	9606.ENSP00000264428	0.642	Glycine receptor subunit beta
11	9606.ENSP00000303231	0.629	Interleukin-12 subunit alpha
12	9606.ENSP00000253401	0.616	Rho guanine nucleotide exchange factor 9
13	9606.ENSP00000383295	0.610	Neurobeachin
14	9606.ENSP00000308725	0.601	Gamma-aminobutyric acid receptor subunit beta-3
15	9606.ENSP00000339867	0.601	Chloride channel protein 1
16	9606.ENSP00000295454	0.598	Gamma-aminobutyric acid receptor subunit beta-1
17	9606.ENSP00000419378	0.597	Chloride intracellular channel protein 3
18	9606.ENSP00000274547	0.591	Gamma-aminobutyric acid receptor subunit beta-2
19	9606.ENSP00000393097	0.585	Gamma-aminobutyric acid receptor subunit alpha-1
20	9606.ENSP00000265593	0.584	Chloride channel protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016933	0.997	extracellularly glycine-gated ion channel activity
GO:0005254	0.997	chloride channel activity
GO:0099095	0.996	ligand-gated monoatomic anion channel activity
GO:0016934	0.992	extracellularly glycine-gated chloride channel activity
GO:0005488	0.974	binding
GO:0030594	0.970	neurotransmitter receptor activity
GO:0005515	0.822	protein binding
GO:0004888	0.793	transmembrane signaling receptor activity
GO:0022824	0.741	transmitter-gated monoatomic ion channel activity
GO:0098960	0.444	postsynaptic neurotransmitter receptor activity
GO:1904315	0.363	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.976	regulation of biological process
GO:0006821	0.975	chloride transport
GO:0050896	0.969	response to stimulus
GO:0050794	0.969	regulation of cellular process
GO:0032501	0.959	multicellular organismal process
GO:0042221	0.928	response to chemical
GO:0007154	0.909	cell communication
GO:0050905	0.900	neuromuscular process
GO:1901698	0.875	response to nitrogen compound
GO:0001101	0.873	response to acid chemical
GO:1902476	0.828	chloride transmembrane transport
GO:0023052	0.801	signaling
GO:0010033	0.791	response to organic substance
GO:0032502	0.781	developmental process
GO:0048856	0.773	anatomical structure development
GO:0051716	0.764	cellular response to stimulus
GO:0001964	0.744	startle response
GO:0043200	0.744	response to amino acid
GO:0007275	0.741	multicellular organism development
GO:0048523	0.715	negative regulation of cellular process
GO:0007165	0.649	signal transduction
GO:0048731	0.624	system development
GO:0007267	0.521	cell-cell signaling
GO:0045664	0.513	regulation of neuron differentiation
GO:0007399	0.438	nervous system development
GO:0007610	0.395	behavior
GO:0007417	0.386	central nervous system development
GO:0099536	0.312	synaptic signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.970	organelle
GO:0030054	0.720	cell junction
GO:0045202	0.633	synapse
GO:0005737	0.624	cytoplasm
GO:0098590	0.589	plasma membrane region
GO:0043229	0.465	intracellular organelle
GO:0098794	0.463	postsynapse
GO:0097060	0.417	synaptic membrane
GO:0032991	0.393	protein-containing complex
GO:0043227	0.323	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.997	chloride(in) = chloride(out)

[back to server]