StarFunc result for job id P23434

User Input

>input (173 residues)
MALRVVRSVRALLCTLRAVPSPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWV
TTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEV
TEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23434	1.000	1.000	1.857E-31	173	1.000	1.000	P23434.pdb.gz	GCSH_HUMAN Glycine cleavage system H protein, mitochondrial OS=Homo sapiens OX=9606 GN=GCSH PE=1 SV=2
2	AFDB:P20821	0.747	0.747	9.868E-29	173	0.896	0.896	P20821.pdb.gz	GCSH_BOVIN Glycine cleavage system H protein, mitochondrial OS=Bos taurus OX=9913 GN=GCSH PE=1 SV=1
3	AFDB:Q5I0P2	0.746	0.759	4.218E-28	170	0.850	0.865	Q5I0P2.pdb.gz	GCSH_RAT Glycine cleavage system H protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gcsh PE=2 SV=1
4	AFDB:P11183	0.737	0.777	2.767E-26	164	0.711	0.750	P11183.pdb.gz	GCSH_CHICK Glycine cleavage system H protein, mitochondrial OS=Gallus gallus OX=9031 GN=GCSH PE=1 SV=2
5	AFDB:Q9HDV9	0.712	0.729	1.951E-18	169	0.370	0.379	Q9HDV9.pdb.gz	GCSH_SCHPO Putative glycine cleavage system H protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcv3 PE=1 SV=1
6	AFDB:Q9LQL0	0.705	0.734	5.552E-18	166	0.405	0.422	Q9LQL0.pdb.gz	GCSH3_ARATH Glycine cleavage system H protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDH3 PE=1 SV=1
7	AFDB:P16048	0.704	0.738	1.252E-17	165	0.382	0.400	P16048.pdb.gz	GCSH_PEA Glycine cleavage system H protein, mitochondrial OS=Pisum sativum OX=3888 GN=GDCSH PE=1 SV=1
8	AFDB:O82179	0.706	0.781	2.373E-17	156	0.353	0.391	O82179.pdb.gz	GCSH2_ARATH Glycine cleavage system H protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDH2 PE=2 SV=1
9	AFDB:O32174	0.691	0.937	3.243E-16	127	0.301	0.409	O32174.pdb.gz	GCSH_BACSU Glycine cleavage system H protein OS=Bacillus subtilis (strain 168) OX=224308 GN=gcvH PE=1 SV=1
10	AFDB:Q38E17	0.669	0.835	1.234E-15	138	0.347	0.435	Q38E17.pdb.gz	Q38E17_TRYB2 Glycine cleavage system H protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1380 PE=3 SV=1
11	PDB:3a7lA	0.687	0.922	1.303E-14	128	0.312	0.422	3a7lA.pdb.gz
12	PDB:7wtbB	0.200	0.032	1.001E-2	1147	0.075	0.011	7wtbB.pdb.gz	Mechanistic insight into allosteric activation of human pyruvate carboxylase by acetyl-CoA.
13	PDB:3bg5B	0.223	0.040	1.061E-2	1074	0.087	0.014	3bg5B.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
14	PDB:4hnvB	0.217	0.041	1.419E-2	1033	0.087	0.015	4hnvB.pdb.gz	Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.
15	PDB:4rcnB	0.317	0.061	2.537E-2	1000	0.098	0.017	4rcnB.pdb.gz
16	PDB:3n6rA	0.247	0.080	2.850E-2	591	0.104	0.030	3n6rA.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
17	PDB:3n6rG	0.196	0.055	3.201E-2	646	0.087	0.023	3n6rG.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
18	PDB:4hr7B	0.222	0.451	5.401E-2	80	0.075	0.163	4hr7B.pdb.gz
19	PDB:3bg5A	0.222	0.041	7.222E-2	1137	0.081	0.012	3bg5A.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
20	PDB:7xk3A	0.252	0.105	9.111E-2	446	0.075	0.029	7xk3A.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23434	1.05e-125	352	173	1.000	1.000	GCSH_HUMAN Glycine cleavage system H protein, mitochondrial OS=Homo sapiens OX=9606 GN=GCSH PE=1 SV=2
2	Q53XL7	1.19e-124	349	173	0.994	0.994	Q53XL7_HUMAN Glycine cleavage system H protein OS=Homo sapiens OX=9606 GN=GCSH PE=1 SV=1
3	P20821	1.90e-111	316	173	0.896	0.896	GCSH_BOVIN Glycine cleavage system H protein, mitochondrial OS=Bos taurus OX=9913 GN=GCSH PE=1 SV=1
4	Q5I0P2	8.09e-105	299	170	0.850	0.865	GCSH_RAT Glycine cleavage system H protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gcsh PE=2 SV=1
5	Q91WK5	3.89e-97	280	170	0.803	0.818	GCSH_MOUSE Glycine cleavage system H protein, mitochondrial OS=Mus musculus OX=10090 GN=Gcsh PE=1 SV=2
6	P11183	3.75e-84	246	164	0.711	0.750	GCSH_CHICK Glycine cleavage system H protein, mitochondrial OS=Gallus gallus OX=9031 GN=GCSH PE=1 SV=2
7	Q9LQL0	4.91e-39	132	166	0.358	0.373	GCSH3_ARATH Glycine cleavage system H protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDH3 PE=1 SV=1
8	P25855	1.49e-38	131	165	0.353	0.370	GCSH1_ARATH Glycine cleavage system H protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDH1 PE=1 SV=1
9	O82179	1.63e-37	128	156	0.335	0.372	GCSH2_ARATH Glycine cleavage system H protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDH2 PE=2 SV=1
10	Q9HDV9	5.71e-36	124	169	0.335	0.343	GCSH_SCHPO Putative glycine cleavage system H protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcv3 PE=1 SV=1
11	P16048	1.75e-35	123	165	0.329	0.345	GCSH_PEA Glycine cleavage system H protein, mitochondrial OS=Pisum sativum OX=3888 GN=GDCSH PE=1 SV=1
12	O32174	4.65e-33	116	127	0.301	0.409	GCSH_BACSU Glycine cleavage system H protein OS=Bacillus subtilis (strain 168) OX=224308 GN=gcvH PE=1 SV=1
13	Q38E17	1.87e-32	114	138	0.324	0.406	Q38E17_TRYB2 Glycine cleavage system H protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1380 PE=3 SV=1
14	P0A6T9	6.40e-32	113	129	0.312	0.419	GCSH_ECOLI Glycine cleavage system H protein OS=Escherichia coli (strain K12) OX=83333 GN=gcvH PE=1 SV=2
15	P39726	2.55e-31	112	170	0.324	0.329	GCSH_YEAST Glycine cleavage system H protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCV3 PE=1 SV=3
16	Q54JV8	6.29e-27	100	146	0.266	0.315	GCSH1_DICDI Probable glycine cleavage system H protein 1, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=gcvH1 PE=3 SV=1
17	Q8II35	1.94e-08	53.5	200	0.197	0.170	Q8II35_PLAF7 Glycine cleavage system H protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1132900 PE=3 SV=1
18	Q9M236	3.5	30.4	373	0.168	0.078	Q9M236_ARATH Initiation factor 4F subunit (DUF1350) OS=Arabidopsis thaliana OX=3702 GN=T18D12_110 PE=1 SV=1
19	Q9Y7U7	3.6	30.4	878	0.139	0.027	SND1_SCHPO Staphylococcal nuclease domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snd1 PE=1 SV=1
20	Q9ER58	4.5	30.0	423	0.081	0.033	TICN2_MOUSE Testican-2 OS=Mus musculus OX=10090 GN=Spock2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01597 GCV_H	9.7e-47	169.3	Glycine cleavage H-protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319531

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000273588	0.999	Aminomethyltransferase, mitochondrial
2	9606.ENSP00000370737	0.999	Glycine dehydrogenase (decarboxylating), mitochondrial
3	9606.ENSP00000309463	0.995	Putative lipoyltransferase 2, mitochondrial
4	9606.ENSP00000377115	0.993	Lipoyltransferase 1, mitochondrial
5	9606.ENSP00000205402	0.990	Dihydrolipoyl dehydrogenase, mitochondrial
6	9606.ENSP00000280346	0.985	Dihydrolipoamide S-acetyltransferase
7	9606.ENSP00000335304	0.983	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
8	9606.ENSP00000318868	0.981	Serine hydroxymethyltransferase, cytosolic
9	9606.ENSP00000333667	0.979	Serine hydroxymethyltransferase, mitochondrial
10	9606.ENSP00000261434	0.977	Lipoyl synthase, mitochondrial
11	9606.ENSP00000227868	0.971	Pyruvate dehydrogenase protein X component, mitochondrial
12	9606.ENSP00000302620	0.956	Alanine-glyoxylate aminotransferase
13	9606.ENSP00000359151	0.947	Dihydrolipoamide branched chain transacylase E2
14	9606.ENSP00000458770	0.938	Acyl carrier protein, mitochondrial
15	9606.ENSP00000269980	0.926	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
16	9606.ENSP00000318351	0.926	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
17	9606.ENSP00000222673	0.920	2-oxoglutarate dehydrogenase, mitochondrial
18	9606.ENSP00000369134	0.920	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
19	9606.ENSP00000263035	0.917	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
20	9606.ENSP00000307241	0.917	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016742	1.000	hydroxymethyl-, formyl- and related transferase activity
GO:0004047	0.981	aminomethyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.995	primary metabolic process
GO:0019752	0.995	carboxylic acid metabolic process
GO:0006544	0.990	glycine metabolic process
GO:0009063	0.990	amino acid catabolic process
GO:1901606	0.953	alpha-amino acid catabolic process
GO:0009071	0.913	serine family amino acid catabolic process
GO:0051604	0.909	protein maturation
GO:0036211	0.849	protein modification process
GO:0018205	0.810	peptidyl-lysine modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.961	intracellular organelle lumen
GO:0032991	0.942	protein-containing complex
GO:0005759	0.804	mitochondrial matrix
GO:1902494	0.582	catalytic complex
GO:0031981	0.562	nuclear lumen
GO:1990204	0.462	oxidoreductase complex
GO:0005654	0.382	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.2.-	1.000	Hydroxymethyl-, formyl- and related transferases.
RHEA:16945	0.981	(6S)-5,6,7,8-tetrahydrofolate + (R)-N(6)-(S(8)-aminomethyldihydrolipoyl)-L-lysyl-[protein] = (6R)-5,10-methylene-5,6,7,8-tetrahydrofolate + (R)-N(6)-dihydrolipoyl-L-lysyl-[protein] + NH4(+)
EC:2.1.2.10	0.981	aminomethyltransferase.

[back to server]