StarFunc result for job id P23443

User Input

>input (525 residues)
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6TJY3	0.802	0.800	5.940E-85	527	0.998	0.994	Q6TJY3.pdb.gz	KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus OX=9913 GN=RPS6KB1 PE=2 SV=1
2	AFDB:Q9Z1M4	0.719	0.776	3.191E-65	485	0.650	0.703	Q9Z1M4.pdb.gz	KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus OX=10090 GN=Rps6kb2 PE=1 SV=1
3	AFDB:Q9NAH6	0.669	0.640	3.602E-55	550	0.509	0.485	Q9NAH6.pdb.gz	KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans OX=6239 GN=rsks-1 PE=1 SV=2
4	AFDB:A0A2R8Q8Y4	0.638	0.491	1.910E-45	685	0.370	0.283	A0A2R8Q8Y4.pdb.gz
5	AFDB:A2RUY2	0.645	0.473	2.787E-45	720	0.377	0.275	A2RUY2.pdb.gz
6	AFDB:A0A384MDW3	0.631	0.450	2.941E-45	740	0.368	0.261	A0A384MDW3.pdb.gz	A0A384MDW3_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 PE=2 SV=1
7	AFDB:Q15418	0.643	0.461	4.528E-45	735	0.368	0.263	Q15418.pdb.gz	KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2
8	AFDB:Q9UK32	0.641	0.454	1.196E-44	745	0.381	0.268	Q9UK32.pdb.gz	KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens OX=9606 GN=RPS6KA6 PE=1 SV=1
9	AFDB:Q9VR61	0.662	0.388	3.334E-44	911	0.373	0.215	Q9VR61.pdb.gz	Q9VR61_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=S6kII PE=3 SV=1
10	AFDB:A0A0R4ID09	0.631	0.454	3.519E-44	733	0.368	0.263	A0A0R4ID09.pdb.gz	A0A0R4ID09_DANRE Ribosomal protein S6 kinase OS=Danio rerio OX=7955 GN=id:ibd1103 PE=1 SV=1
11	PDB:3pfqA	0.578	0.580	1.392E-31	523	0.246	0.247	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:6byrA	0.542	0.699	1.205E-30	405	0.219	0.284	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
13	PDB:4mk0A	0.562	0.472	2.182E-30	631	0.215	0.179	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
14	PDB:6pjxA	0.570	0.552	2.707E-30	543	0.229	0.221	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
15	PDB:3pvuA	0.555	0.481	1.789E-29	609	0.208	0.179	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
16	PDB:4yhjA	0.559	0.584	2.959E-28	501	0.221	0.232	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
17	PDB:3nynA	0.570	0.541	6.298E-28	554	0.227	0.215	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
18	PDB:5x3fB	0.511	0.759	6.298E-28	349	0.208	0.312	5x3fB.pdb.gz
19	PDB:6s9wA	0.481	0.608	9.189E-28	411	0.270	0.345	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
20	PDB:3c4wB	0.547	0.553	1.140E-27	519	0.202	0.204	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTB9	0.0	586	392	0.549	0.735	A0A0G2JTB9_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Rps6kb2 PE=1 SV=1
2	D4AE24	0.0	649	482	0.632	0.689	D4AE24_RAT Ribosomal protein S6 kinase OS=Rattus norvegicus OX=10116 GN=Rps6kb2 PE=3 SV=2
3	F1MNP4	0.0	1089	525	0.998	0.998	F1MNP4_BOVIN Ribosomal protein S6 kinase OS=Bos taurus OX=9913 GN=RPS6KB1 PE=3 SV=1
4	P23443	0.0	1091	525	1.000	1.000	KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens OX=9606 GN=RPS6KB1 PE=1 SV=2
5	P67999	0.0	1086	525	0.996	0.996	KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus OX=10116 GN=Rps6kb1 PE=1 SV=1
6	P91656	0.0	565	637	0.510	0.421	P91656_DROME Ribosomal protein S6 kinase OS=Drosophila melanogaster OX=7227 GN=S6k PE=1 SV=1
7	Q6TJY3	0.0	1090	527	0.998	0.994	KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus OX=9913 GN=RPS6KB1 PE=2 SV=1
8	Q8BSK8	0.0	1083	525	0.994	0.994	KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus OX=10090 GN=Rps6kb1 PE=1 SV=2
9	Q94533	0.0	565	490	0.510	0.547	Q94533_DROME Ribosomal protein S6 kinase OS=Drosophila melanogaster OX=7227 GN=S6k PE=1 SV=2
10	Q9UBS0	0.0	669	482	0.619	0.674	KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens OX=9606 GN=RPS6KB2 PE=1 SV=2
11	Q9Z1M4	0.0	660	485	0.636	0.689	KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus OX=10090 GN=Rps6kb2 PE=1 SV=1
12	Q9NAH6	5.70e-177	511	550	0.457	0.436	KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans OX=6239 GN=rsks-1 PE=1 SV=2
13	I6L9G9	1.60e-135	397	312	0.394	0.663	I6L9G9_RAT Rps6kb2 protein OS=Rattus norvegicus OX=10116 GN=Rps6kb2 PE=2 SV=1
14	Q9PTN1	6.35e-127	389	737	0.368	0.262	Q9PTN1_XENLA Ribosomal protein S6 kinase OS=Xenopus laevis OX=8355 GN=rps6ka3.L PE=1 SV=1
15	Q9WUT3	2.65e-124	382	733	0.350	0.251	KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus OX=10090 GN=Rps6ka2 PE=1 SV=1
16	Q15349	3.58e-124	382	733	0.350	0.251	KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens OX=9606 GN=RPS6KA2 PE=1 SV=2
17	Q15418	6.25e-124	381	735	0.364	0.260	KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2
18	A0A384MDW3	6.83e-124	382	740	0.370	0.262	A0A384MDW3_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 PE=2 SV=1
19	P51812	6.83e-124	382	740	0.370	0.262	KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1
20	Q63531	1.03e-123	381	735	0.354	0.253	KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus OX=10116 GN=Rps6ka1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4.3	17.9	ABC1 atypical kinase-like domain
2	PF01636 APH	5e+02	11.9	Phosphotransferase enzyme family
3	PF13095 FTA2	5.4e+02	11.6	Kinetochore Sim4 complex subunit FTA2
4	PF14531 Kinase-like	0.00025	32.1	Kinase-like
5	PF00069 Pkinase	2.3e-66	235.5	Protein kinase domain
6	PF00433 Pkinase_C	8.5e-07	40.9	Protein kinase C terminal domain
7	PF17667 Pkinase_fungal	0.13	22.6	Fungal protein kinase
8	PF07714 PK_Tyr_Ser-Thr	2.3e-33	127.1	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 225400.XP_006770293.1

Rank	PPI partner	STRING score	Description
1	225400.XP_006766786.1	0.999	Belongs to the PI3/PI4-kinase family.
2	225400.XP_006764990.1	0.992	40S ribosomal protein S6
3	225400.XP_006753118.1	0.990	Regulatory-associated protein of mTOR
4	225400.XP_006763964.1	0.980	Target of rapamycin complex subunit LST8
5	225400.XP_006765993.1	0.979	Proline-rich AKT1 substrate 1
6	225400.XP_006763473.1	0.978	Insulin receptor substrate 1
7	225400.XP_006775260.1	0.977	3-phosphoinositide-dependent protein kinase 1-like
8	225400.XP_006757090.1	0.970	Eukaryotic translation initiation factor 4B isoform X1
9	225400.XP_006763729.1	0.953	RAC-beta serine/threonine-protein kinase
10	225400.XP_006753636.1	0.949	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
11	225400.XP_006765676.1	0.949	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
12	225400.XP_006761803.1	0.947	Rapamycin-insensitive companion of mTOR isoform X1
13	225400.XP_006769026.1	0.934	Mitogen-activated protein kinase 1
14	225400.XP_006757832.1	0.932	Mitogen-activated protein kinase
15	225400.XP_006767343.1	0.931	Ras homolog enriched in brain
16	225400.XP_006769154.1	0.914	DEP domain-containing mTOR-interacting protein
17	225400.XP_006773095.1	0.898	Eukaryotic translation initiation factor 4E
18	225400.XP_006770943.1	0.897	Forkhead box protein A2
19	225400.XP_006776010.1	0.891	Polymerase delta-interacting protein 3
20	225400.XP_006765559.1	0.887	RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre- initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents p [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0097159	0.563	organic cyclic compound binding
GO:1901363	0.436	heterocyclic compound binding
GO:0019899	0.367	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0009987	0.990	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0051716	0.982	cellular response to stimulus
GO:0009719	0.925	response to endogenous stimulus
GO:0043434	0.898	response to peptide hormone
GO:0023052	0.887	signaling
GO:0032868	0.862	response to insulin
GO:0007154	0.860	cell communication
GO:0007165	0.854	signal transduction
GO:0071495	0.826	cellular response to endogenous stimulus
GO:0048518	0.780	positive regulation of biological process
GO:0008152	0.749	metabolic process
GO:0071310	0.737	cellular response to organic substance
GO:0044237	0.723	cellular metabolic process
GO:0019222	0.720	regulation of metabolic process
GO:0071704	0.717	organic substance metabolic process
GO:0044238	0.713	primary metabolic process
GO:0006807	0.683	nitrogen compound metabolic process
GO:0048522	0.673	positive regulation of cellular process
GO:1901564	0.667	organonitrogen compound metabolic process
GO:0043170	0.665	macromolecule metabolic process
GO:0019538	0.657	protein metabolic process
GO:0032870	0.619	cellular response to hormone stimulus
GO:0060255	0.583	regulation of macromolecule metabolic process
GO:1901699	0.564	cellular response to nitrogen compound
GO:0006796	0.527	phosphate-containing compound metabolic process
GO:0031323	0.526	regulation of cellular metabolic process
GO:0080090	0.487	regulation of primary metabolic process
GO:0036211	0.463	protein modification process
GO:0035556	0.458	intracellular signal transduction
GO:0048519	0.448	negative regulation of biological process
GO:0048523	0.440	negative regulation of cellular process
GO:0051171	0.437	regulation of nitrogen compound metabolic process
GO:0048583	0.420	regulation of response to stimulus
GO:0009893	0.401	positive regulation of metabolic process
GO:0016310	0.390	phosphorylation
GO:0010468	0.369	regulation of gene expression
GO:0010604	0.348	positive regulation of macromolecule metabolic process
GO:1901701	0.346	cellular response to oxygen-containing compound
GO:0006950	0.338	response to stress
GO:0009966	0.328	regulation of signal transduction
GO:0071417	0.305	cellular response to organonitrogen compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0005829	0.983	cytosol
GO:0030054	0.857	cell junction
GO:0016020	0.813	membrane
GO:0045202	0.696	synapse
GO:0005739	0.497	mitochondrion
GO:0032991	0.318	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]