StarFunc result for job id P23458

User Input

>input (1154 residues)
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
SFQNLIEGFEALLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZD03	0.906	0.882	0.000	1186	0.461	0.449	D3ZD03.pdb.gz	D3ZD03_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tyk2 PE=1 SV=1
2	AFDB:O12990	0.665	0.665	0.000	1153	0.624	0.624	O12990.pdb.gz	JAK1_DANRE Tyrosine-protein kinase JAK1 OS=Danio rerio OX=7955 GN=jak1 PE=1 SV=1
3	AFDB:P23458	1.000	1.000	0.000	1154	1.000	1.000	P23458.pdb.gz	JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens OX=9606 GN=JAK1 PE=1 SV=2
4	AFDB:P29597	0.643	0.625	0.000	1187	0.458	0.445	P29597.pdb.gz	TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2 OS=Homo sapiens OX=9606 GN=TYK2 PE=1 SV=3
5	AFDB:S5R2L7	0.651	0.639	0.000	1176	0.481	0.472	S5R2L7.pdb.gz	S5R2L7_SALSA Tyrosine-protein kinase OS=Salmo salar OX=8030 PE=2 SV=1
6	AFDB:G1TCI4	0.613	0.625	1.476E-101	1132	0.432	0.440	G1TCI4.pdb.gz	G1TCI4_RABIT Tyrosine-protein kinase OS=Oryctolagus cuniculus OX=9986 GN=JAK2 PE=3 SV=2
7	AFDB:B0V237	0.856	0.894	8.432E-98	1103	0.392	0.410	B0V237.pdb.gz	B0V237_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak3 PE=3 SV=1
8	AFDB:F1QWX8	0.605	0.637	9.201E-98	1095	0.409	0.431	F1QWX8.pdb.gz	F1QWX8_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak4 PE=3 SV=1
9	AFDB:P52333	0.865	0.888	1.004E-97	1124	0.390	0.400	P52333.pdb.gz	JAK3_HUMAN Tyrosine-protein kinase JAK3 OS=Homo sapiens OX=9606 GN=JAK3 PE=1 SV=2
10	AFDB:Q62137	0.604	0.632	3.802E-92	1100	0.382	0.401	Q62137.pdb.gz	JAK3_MOUSE Tyrosine-protein kinase JAK3 OS=Mus musculus OX=10090 GN=Jak3 PE=1 SV=2
11	PDB:4fl2A	0.209	0.418	1.026E-19	555	0.127	0.265	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	PDB:4k2rA	0.206	0.419	7.421E-18	551	0.086	0.180	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
13	PDB:1k9aB	0.208	0.528	4.450E-17	441	0.078	0.204	1k9aB.pdb.gz
14	PDB:2h8hA	0.207	0.512	1.650E-16	445	0.080	0.207	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:4krcA	0.196	0.689	8.163E-14	297	0.059	0.229	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:4eomC	0.200	0.771	1.379E-13	276	0.062	0.261	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
17	PDB:1unlA	0.192	0.698	3.027E-13	292	0.052	0.205	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
18	PDB:6s73A	0.199	0.785	3.451E-13	269	0.057	0.245	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
19	PDB:4yc3A	0.186	0.657	4.686E-13	295	0.067	0.261	4yc3A.pdb.gz
20	PDB:5ufuA	0.208	0.616	5.114E-13	369	0.062	0.195	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZU24	2189	1140	0.921	0.932	A0A8I5ZU24_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=1 SV=1
2	A0A8I6AJU1	2110	1120	0.889	0.916	A0A8I6AJU1_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=1 SV=1
3	A0A8I6AM23	2250	1153	0.945	0.946	A0A8I6AM23_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=1 SV=1
4	B0V237	787	1103	0.392	0.410	B0V237_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak3 PE=3 SV=1
5	D3ZD03	994	1186	0.457	0.444	D3ZD03_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tyk2 PE=1 SV=1
6	F1QWX8	832	1095	0.410	0.432	F1QWX8_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak4 PE=3 SV=1
7	G1TCI4	902	1132	0.433	0.442	G1TCI4_RABIT Tyrosine-protein kinase OS=Oryctolagus cuniculus OX=9986 GN=JAK2 PE=3 SV=2
8	G3V9W2	2254	1153	0.946	0.947	G3V9W2_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=3 SV=1
9	K7GSE8	771	1103	0.391	0.409	K7GSE8_PIG Tyrosine-protein kinase OS=Sus scrofa OX=9823 GN=JAK3 PE=3 SV=1
10	O12990	1479	1153	0.623	0.624	JAK1_DANRE Tyrosine-protein kinase JAK1 OS=Danio rerio OX=7955 GN=jak1 PE=1 SV=1
11	O35803	1642	866	0.700	0.933	O35803_RAT Tyrosine-protein kinase (Fragment) OS=Rattus norvegicus OX=10116 GN=Jak1 PE=2 SV=1
12	O60674	902	1132	0.436	0.444	JAK2_HUMAN Tyrosine-protein kinase JAK2 OS=Homo sapiens OX=9606 GN=JAK2 PE=1 SV=2
13	O93596	830	1095	0.403	0.425	O93596_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak4 PE=2 SV=1
14	P23458	2415	1154	1.000	1.000	JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens OX=9606 GN=JAK1 PE=1 SV=2
15	P29597	1019	1187	0.462	0.449	TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2 OS=Homo sapiens OX=9606 GN=TYK2 PE=1 SV=3
16	P52332	2239	1153	0.946	0.947	JAK1_MOUSE Tyrosine-protein kinase JAK1 OS=Mus musculus OX=10090 GN=Jak1 PE=1 SV=1
17	P52333	769	1124	0.387	0.398	JAK3_HUMAN Tyrosine-protein kinase JAK3 OS=Homo sapiens OX=9606 GN=JAK3 PE=1 SV=2
18	Q62120	899	1132	0.433	0.442	JAK2_MOUSE Tyrosine-protein kinase JAK2 OS=Mus musculus OX=10090 GN=Jak2 PE=1 SV=3
19	Q62137	748	1100	0.381	0.400	JAK3_MOUSE Tyrosine-protein kinase JAK3 OS=Mus musculus OX=10090 GN=Jak3 PE=1 SV=2
20	Q62689	898	1132	0.432	0.441	JAK2_RAT Tyrosine-protein kinase JAK2 OS=Rattus norvegicus OX=10116 GN=Jak2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.6	20.7	ABC1 atypical kinase-like domain
2	PF01636 APH	5.8e+02	11.7	Phosphotransferase enzyme family
3	PF18379 FERM_F1	8.8e-29	110.8	FERM F1 ubiquitin-like domain
4	PF18377 FERM_F2	5.1e-53	189.9	FERM F2 acyl-CoA binding protein-like domain
5	PF17887 Jak1_Phl	1.8e-53	191.6	Jak1 pleckstrin homology-like domain
6	PF14531 Kinase-like	3.3	18.6	Kinase-like
7	PF00069 Pkinase	9.3e-69	243.3	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	1e-145	495.4	Protein tyrosine and serine/threonine kinase
9	PF00017 SH2	53	15.3	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343204

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227752	0.999	Interleukin-10 receptor subunit alpha
2	9606.ENSP00000264657	0.999	Signal transducer and activator of transcription 3
3	9606.ENSP00000270139	0.999	Interferon alpha/beta receptor 1
4	9606.ENSP00000330341	0.999	Suppressor of cytokine signaling 3
5	9606.ENSP00000343957	0.999	Interferon alpha/beta receptor 2
6	9606.ENSP00000354394	0.999	Signal transducer and activator of transcription 1-alpha/beta
7	9606.ENSP00000356713	0.999	Interferon gamma receptor 1
8	9606.ENSP00000306157	0.998	Interleukin-7 receptor subunit alpha
9	9606.ENSP00000341208	0.998	Signal transducer and activator of transcription 5A
10	9606.ENSP00000370698	0.998	Interleukin-6 receptor subunit beta
11	9606.ENSP00000216223	0.997	Interleukin-2 receptor subunit beta
12	9606.ENSP00000290219	0.997	Interferon gamma receptor 2
13	9606.ENSP00000293328	0.997	Signal transducer and activator of transcription 5B
14	9606.ENSP00000340944	0.997	Tyrosine-protein phosphatase non-receptor type 11
15	9606.ENSP00000304895	0.996	Insulin receptor substrate 1
16	9606.ENSP00000327824	0.995	Interferon lambda receptor 1
17	9606.ENSP00000363318	0.995	Cytokine receptor common subunit gamma
18	9606.ENSP00000290200	0.993	Interleukin-10 receptor subunit beta
19	9606.ENSP00000329418	0.992	Suppressor of cytokine signaling 1
20	9606.ENSP00000300134	0.991	Signal transducer and activator of transcription 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005131	1.000	growth hormone receptor binding
GO:0004672	1.000	protein kinase activity
GO:0048020	0.999	CCR chemokine receptor binding
GO:0004713	0.983	protein tyrosine kinase activity
GO:0019899	0.833	enzyme binding
GO:0004715	0.790	non-membrane spanning protein tyrosine kinase activity
GO:0019902	0.737	phosphatase binding
GO:0019903	0.725	protein phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051716	0.997	cellular response to stimulus
GO:0007154	0.996	cell communication
GO:0007165	0.989	signal transduction
GO:0044237	0.985	cellular metabolic process
GO:0006793	0.978	phosphorus metabolic process
GO:0048522	0.978	positive regulation of cellular process
GO:0042221	0.974	response to chemical
GO:0007166	0.969	cell surface receptor signaling pathway
GO:0071704	0.960	organic substance metabolic process
GO:0019221	0.958	cytokine-mediated signaling pathway
GO:0006796	0.953	phosphate-containing compound metabolic process
GO:0044238	0.949	primary metabolic process
GO:0043170	0.946	macromolecule metabolic process
GO:0016310	0.939	phosphorylation
GO:0036211	0.937	protein modification process
GO:0006468	0.904	protein phosphorylation
GO:0048583	0.871	regulation of response to stimulus
GO:0019222	0.840	regulation of metabolic process
GO:0060255	0.790	regulation of macromolecule metabolic process
GO:0097696	0.774	receptor signaling pathway via STAT
GO:0007259	0.708	receptor signaling pathway via JAK-STAT
GO:0002376	0.683	immune system process
GO:0023051	0.664	regulation of signaling
GO:0010646	0.664	regulation of cell communication
GO:0009893	0.617	positive regulation of metabolic process
GO:0010604	0.564	positive regulation of macromolecule metabolic process
GO:0080090	0.553	regulation of primary metabolic process
GO:0031323	0.552	regulation of cellular metabolic process
GO:0010468	0.543	regulation of gene expression
GO:0032501	0.540	multicellular organismal process
GO:0051171	0.524	regulation of nitrogen compound metabolic process
GO:0009966	0.521	regulation of signal transduction
GO:0048584	0.494	positive regulation of response to stimulus
GO:0032502	0.485	developmental process
GO:0023056	0.484	positive regulation of signaling
GO:0010647	0.484	positive regulation of cell communication
GO:0051239	0.451	regulation of multicellular organismal process
GO:0048519	0.449	negative regulation of biological process
GO:0006950	0.438	response to stress
GO:0009967	0.437	positive regulation of signal transduction
GO:0048856	0.426	anatomical structure development
GO:0009605	0.385	response to external stimulus
GO:0018193	0.377	peptidyl-amino acid modification
GO:0035556	0.366	intracellular signal transduction
GO:0048523	0.353	negative regulation of cellular process
GO:0051240	0.351	positive regulation of multicellular organismal process
GO:0031325	0.346	positive regulation of cellular metabolic process
GO:0051173	0.338	positive regulation of nitrogen compound metabolic process
GO:1904892	0.338	regulation of receptor signaling pathway via STAT
GO:0018108	0.336	peptidyl-tyrosine phosphorylation
GO:0009889	0.316	regulation of biosynthetic process
GO:0050793	0.315	regulation of developmental process
GO:0031326	0.308	regulation of cellular biosynthetic process
GO:0030155	0.306	regulation of cell adhesion
GO:0007167	0.305	enzyme-linked receptor protein signaling pathway
GO:0051707	0.303	response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.967	organelle
GO:0043231	0.959	intracellular membrane-bounded organelle
GO:0012505	0.922	endomembrane system
GO:0005634	0.919	nucleus
GO:0016020	0.906	membrane
GO:0071944	0.774	cell periphery
GO:0031982	0.725	vesicle
GO:0005886	0.704	plasma membrane
GO:0030054	0.599	cell junction
GO:0031410	0.439	cytoplasmic vesicle
GO:0070161	0.343	anchoring junction
GO:0030055	0.310	cell-substrate junction
GO:0005768	0.308	endosome
GO:0005925	0.302	focal adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:10596	0.983	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.790	non-specific protein-tyrosine kinase.

[back to server]