StarFunc result for job id P23467

User Input

>input (1997 residues)
MLSHGAGLALWITLSLLQTGLAEPERCNFTLAESKASSHSVSIQWRILGSPCNFSLIYSS
DTLGAALCPTFRIDNTTYGCNLQDLQAGTIYNFRIISLDEERTVVLQTDPLPPARFGVSK
EKTTSTSLHVWWTPSSGKVTSYEVQLFDENNQKIQGVQIQESTSWNEYTFFNLTAGSKYN
IAITAVSGGKRSFSVYTNGSTVPSPVKDIGISTKANSLLISWSHGSGNVERYRLMLMDKG
ILVHGGVVDKHATSYAFHGLTPGYLYNLTVMTEAAGLQNYRWKLVRTAPMEVSNLKVTND
GSLTSLKVKWQRPPGNVDSYNITLSHKGTIKESRVLAPWITETHFKELVPGRLYQVTVSC
VSGELSAQKMAVGRTFPDKVANLEANNNGRMRSLVVSWSPPAGDWEQYRILLFNDSVVLL
NITVGKEETQYVMDDTGLVPGRQYEVEVIVESGNLKNSERCQGRTVPLAVLQLRVKHANE
TSLSIMWQTPVAEWEKYIISLADRDLLLIHKSLSKDAKEFTFTDLVPGRKYMATVTSISG
DLKNSSSVKGRTVPAQVTDLHVANQGMTSSLFTNWTQAQGDVEFYQVLLIHENVVIKNES
ISSETSRYSFHSLKSGSLYSVVVTTVSGGISSRQVVVEGRTVPSSVSGVTVNNSGRNDYL
SVSWLLAPGDVDNYEVTLSHDGKVVQSLVIAKSVRECSFSSLTPGRLYTVTITTRSGKYE
NHSFSQERTVPDKVQGVSVSNSARSDYLRVSWVHATGDFDHYEVTIKNKNNFIQTKSIPK
SENECVFVQLVPGRLYSVTVTTKSGQYEANEQGNGRTIPEPVKDLTLRNRSTEDLHVTWS
GANGDVDQYEIQLLFNDMKVFPPFHLVNTATEYRFTSLTPGRQYKILVLTISGDVQQSAF
IEGFTVPSAVKNIHISPNGATDSLTVNWTPGGGDVDSYTVSAFRHSQKVDSQTIPKHVFE
HTFHRLEAGEQYQIMIASVSGSLKNQINVVGRTVPASVQGVIADNAYSSYSLIVSWQKAA
GVAERYDILLLTENGILLRNTSEPATTKQHKFEDLTPGKKYKIQILTVSGGLFSKEAQTE
GRTVPAAVTDLRITENSTRHLSFRWTASEGELSWYNIFLYNPDGNLQERAQVDPLVQSFS
FQNLLQGRMYKMVIVTHSGELSNESFIFGRTVPASVSHLRGSNRNTTDSLWFNWSPASGD
FDFYELILYNPNGTKKENWKDKDLTEWRFQGLVPGRKYVLWVVTHSGDLSNKVTAESRTA
PSPPSLMSFADIANTSLAITWKGPPDWTDYNDFELQWLPRDALTVFNPYNNRKSEGRIVY
GLRPGRSYQFNVKTVSGDSWKTYSKPIFGSVRTKPDKIQNLHCRPQNSTAIACSWIPPDS
DFDGYSIECRKMDTQEVEFSRKLEKEKSLLNIMMLVPHKRYLVSIKVQSAGMTSEVVEDS
TITMIDRPPPPPPHIRVNEKDVLISKSSINFTVNCSWFSDTNGAVKYFTVVVREADGSDE
LKPEQQHPLPSYLEYRHNASIRVYQTNYFASKCAENPNSNSKSFNIKLGAEMESLGGKCD
PTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSDTFFSLPITTESEPLFGAI
EGVSAGLFLIGMLVAVVALLICRQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTS
CPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYD
ATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVM
VTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLI
RHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRI
LQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPI
YENVNPEYHRDPVYSRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K2W0	0.281	0.253	0.000	2238	0.841	0.751	A0A0G2K2W0.pdb.gz	A0A0G2K2W0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=1 SV=2
2	AFDB:A0A0R4ITJ9	0.159	0.167	0.000	1892	0.421	0.444	A0A0R4ITJ9.pdb.gz	A0A0R4ITJ9_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=R-PTP-beta PE=3 SV=2
3	AFDB:B6HY54	0.149	0.180	0.000	1650	0.217	0.263	B6HY54.pdb.gz	B6HY54_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=dep1a PE=2 SV=1
4	AFDB:P23467	0.999	0.999	0.000	1997	1.000	1.000	P23467.pdb.gz	PTPRB_HUMAN Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens OX=9606 GN=PTPRB PE=1 SV=3
5	AFDB:Q9UMZ3	0.148	0.127	5.635E-101	2332	0.235	0.202	Q9UMZ3.pdb.gz	PTPRQ_HUMAN Phosphatidylinositol phosphatase PTPRQ OS=Homo sapiens OX=9606 GN=PTPRQ PE=1 SV=2
6	AFDB:P0C5E4	0.142	0.129	4.469E-100	2300	0.227	0.197	P0C5E4.pdb.gz	PTPRQ_MOUSE Phosphatidylinositol phosphatase PTPRQ OS=Mus musculus OX=10090 GN=Ptprq PE=1 SV=1
7	AFDB:Q9W4F5	0.197	0.217	2.871E-96	1767	0.220	0.249	Q9W4F5.pdb.gz	Q9W4F5_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1
8	AFDB:Q64612	0.150	0.175	3.064E-94	1711	0.186	0.217	Q64612.pdb.gz	PTPRV_RAT Receptor-type tyrosine-protein phosphatase V OS=Rattus norvegicus OX=10116 GN=Ptprv PE=1 SV=1
9	AFDB:P70289	0.143	0.167	2.654E-93	1705	0.189	0.222	P70289.pdb.gz	PTPRV_MOUSE Receptor-type tyrosine-protein phosphatase V OS=Mus musculus OX=10090 GN=Ptprv PE=1 SV=1
10	AFDB:B0S602	0.120	0.102	9.994E-78	2480	0.154	0.124	B0S602.pdb.gz	B0S602_DANRE Fibronectin OS=Danio rerio OX=7955 GN=Fn PE=1 SV=1
11	PDB:5xzrA	0.145	0.544	5.455E-23	519	0.062	0.239	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
12	PDB:3ps5A	0.145	0.529	1.503E-22	529	0.061	0.229	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
13	PDB:4gwfA	0.146	0.572	9.993E-22	497	0.060	0.239	4gwfA.pdb.gz
14	PDB:6krwA	0.131	0.810	3.465E-18	306	0.046	0.301	6krwA.pdb.gz
15	PDB:3m4uA	0.127	0.826	2.130E-14	285	0.041	0.288	3m4uA.pdb.gz
16	PDB:5a42A	0.085	0.096	6.697E-14	1597	0.052	0.064	5a42A.pdb.gz
17	PDB:7q1yA	0.065	0.085	2.273E-12	1374	0.046	0.066	7q1yA.pdb.gz
18	PDB:5oj2B	0.069	0.168	5.734E-12	692	0.045	0.130	5oj2B.pdb.gz
19	PDB:7q5zA	0.071	0.095	6.545E-12	1344	0.048	0.071	7q5zA.pdb.gz
20	PDB:1e07A	0.131	0.287	8.525E-12	642	0.029	0.090	1e07A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K2W0	0.0	3492	2240	0.839	0.748	A0A0G2K2W0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=1 SV=2
2	A0A0R4ITJ9	0.0	1588	1892	0.418	0.441	A0A0R4ITJ9_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=R-PTP-beta PE=3 SV=2
3	A0A8I5ZV35	0.0	3529	2000	0.849	0.848	A0A8I5ZV35_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=3 SV=1
4	A0A8I5ZXS1	0.0	3503	2238	0.841	0.751	A0A8I5ZXS1_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=3 SV=1
5	B2RU80	0.0	3591	1998	0.859	0.859	PTPRB_MOUSE Receptor-type tyrosine-protein phosphatase beta OS=Mus musculus OX=10090 GN=Ptprb PE=1 SV=1
6	D3ZTG5	0.0	3516	2004	0.846	0.843	D3ZTG5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=1 SV=3
7	P23467	0.0	4152	1997	1.000	1.000	PTPRB_HUMAN Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens OX=9606 GN=PTPRB PE=1 SV=3
8	P35992	1.37e-158	540	1990	0.222	0.223	PTP10_DROME Tyrosine-protein phosphatase 10D OS=Drosophila melanogaster OX=7227 GN=Ptp10D PE=1 SV=4
9	E1JJE4	1.20e-153	519	1615	0.228	0.282	E1JJE4_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
10	Q8IRS0	1.77e-153	518	1607	0.228	0.283	Q8IRS0_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
11	X2JCK2	8.08e-153	520	1761	0.228	0.258	X2JCK2_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
12	Q9W4F5	1.71e-152	519	1767	0.228	0.257	Q9W4F5_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1
13	Q24495	2.01e-147	504	1767	0.216	0.244	Q24495_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1
14	Q8SXB2	1.40e-133	449	1064	0.168	0.316	Q8SXB2_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1
15	B6HY54	1.74e-133	461	1650	0.234	0.284	B6HY54_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=dep1a PE=2 SV=1
16	Q12913	1.80e-125	432	1337	0.169	0.253	PTPRJ_HUMAN Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens OX=9606 GN=PTPRJ PE=1 SV=3
17	Q64455	2.91e-121	417	1238	0.190	0.307	PTPRJ_MOUSE Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2
18	Q62884	1.12e-118	409	1216	0.185	0.304	Q62884_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 PE=1 SV=1
19	P70289	7.14e-116	409	1705	0.192	0.225	PTPRV_MOUSE Receptor-type tyrosine-protein phosphatase V OS=Mus musculus OX=10090 GN=Ptprv PE=1 SV=1
20	Q64612	1.87e-108	387	1711	0.191	0.223	PTPRV_RAT Receptor-type tyrosine-protein phosphatase V OS=Rattus norvegicus OX=10116 GN=Ptprv PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13363 BetaGal_dom3	1.2e+02	13.7	Beta-galactosidase, domain 3
2	PF00782 DSPc	24	16.2	Dual specificity phosphatase, catalytic domain
3	PF07198 DUF1410	0.64	21.8	Protein of unknown function (DUF1410)
4	PF15983 DUF4767	49	15.7	Domain of unknown function (DUF4767)
5	PF00041 fn3	2.2e-173	574.4	Fibronectin type III domain
6	PF13199 Glyco_hydro_66	7.9	16.6	Glycosyl hydrolase family 66
7	PF18682 PilA4	6.7e+02	12.1	Pilin A4
8	PF14566 PTPlike_phytase	1.9e+02	13.6	Inositol hexakisphosphate
9	PF18861 PTP_tm	3.5e-28	109.8	TM proximal of protein tyrosine phosphatase, receptor type J
10	PF16656 Pur_ac_phosph_N	0.7	21.9	Purple acid Phosphatase, N-terminal domain
11	PF17210 SdrD_B	0.00037	32.0	SdrD B-like domain
12	PF00102 Y_phosphatase	2e-75	265.0	Protein-tyrosine phosphatase
13	PF13350 Y_phosphatase3	9.8	17.7	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334928

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344115	0.997	Cadherin-5
2	9606.ENSP00000341170	0.984	Pleiotrophin
3	9606.ENSP00000369375	0.929	Angiopoietin-1 receptor
4	9606.ENSP00000263923	0.921	Vascular endothelial growth factor receptor 2
5	9606.ENSP00000302978	0.918	Protein sprouty homolog 3
6	9606.ENSP00000344967	0.910	Protein sprouty homolog 4
7	9606.ENSP00000366306	0.910	Protein sprouty homolog 2
8	9606.ENSP00000481675	0.910	Protein sprouty homolog 1
9	9606.ENSP00000344456	0.894	Catenin beta-1
10	9606.ENSP00000447006	0.816	Contactin-1
11	9606.ENSP00000275493	0.795	Epidermal growth factor receptor
12	9606.ENSP00000362680	0.716	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000478570	0.712	Vascular endothelial growth factor A
14	9606.ENSP00000280362	0.693	6-pyruvoyl tetrahydrobiopterin synthase
15	9606.ENSP00000368314	0.680	Neuronal cell adhesion molecule
16	9606.ENSP00000233809	0.635	Insulin-like growth factor-binding protein 2
17	9606.ENSP00000361554	0.634	Tyrosine-protein kinase receptor Tie-1
18	9606.ENSP00000263025	0.625	Mitogen-activated protein kinase 3
19	9606.ENSP00000304604	0.621	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3
20	9606.ENSP00000344786	0.589	Neurofascin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	1.000	cadherin binding
GO:0005001	1.000	transmembrane receptor protein tyrosine phosphatase activity
GO:0005102	0.524	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0016311	0.900	dephosphorylation
GO:0032501	0.894	multicellular organismal process
GO:0032502	0.883	developmental process
GO:0071704	0.849	organic substance metabolic process
GO:0006470	0.836	protein dephosphorylation
GO:0048856	0.808	anatomical structure development
GO:0065007	0.735	biological regulation
GO:0050789	0.694	regulation of biological process
GO:0007275	0.667	multicellular organism development
GO:0048731	0.632	system development
GO:0050794	0.628	regulation of cellular process
GO:0030154	0.524	cell differentiation
GO:0007399	0.461	nervous system development
GO:0022008	0.370	neurogenesis
GO:0048519	0.327	negative regulation of biological process
GO:0050896	0.316	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0016020	1.000	membrane
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.999	intracellular organelle
GO:0005737	0.998	cytoplasm
GO:0012505	0.994	endomembrane system
GO:0005886	0.993	plasma membrane
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0031982	0.987	vesicle
GO:0031410	0.983	cytoplasmic vesicle
GO:0032991	0.982	protein-containing complex
GO:0031090	0.931	organelle membrane
GO:0099503	0.921	secretory vesicle
GO:0098588	0.887	bounding membrane of organelle
GO:0030659	0.875	cytoplasmic vesicle membrane
GO:0030141	0.865	secretory granule
GO:0042581	0.850	specific granule
GO:0030667	0.825	secretory granule membrane
GO:0070820	0.794	tertiary granule
GO:0043235	0.753	receptor complex
GO:0070821	0.735	tertiary granule membrane
GO:0035579	0.612	specific granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]