StarFunc result for job id P23468

User Input

>input (1912 residues)
MVHVARLLLLLLTFFLRTDAETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKK
GKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQ
IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRS
ESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSI
PPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELNDVRQSANY
TCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKP
KNSEELYKEIDGVATTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSA
PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIG
NLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPR
SDTIANYELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEI
SARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAVDGEDDKPH
EILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTNEDVPSGPPRKVEV
EAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDDT
TEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTAL
IQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKEDHFTATDIHKGASYVFRLSARNK
VGFGEEMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRD
INIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVF
AKNFHVKAVMKTSVLLSWEIPENYNSAMPFKILYDDGKMVEEVDGRATQKLIVNLKPEKS
YSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKGY
YIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLP
TEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPI
TDEEEGLIWVVGPVLAVVFIICIVIAILLYKRKRAESDSRKSSIPNNKEIPSHHPTDPVE
LRRLNFQTPGMASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVN
KPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFW
RMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFAL
YKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRT
GCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEV
PARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMP
YESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIV
VMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTV
RQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIV
LERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFDHYAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0H2UKT5	0.308	0.308	0.000	1914	0.685	0.684	A0A0H2UKT5.pdb.gz
2	AFDB:A0A286Y939	0.302	0.735	0.000	780	0.316	0.774	A0A286Y939.pdb.gz
3	AFDB:A4IFW2	0.323	0.323	0.000	1909	0.689	0.690	A4IFW2.pdb.gz	PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1
4	AFDB:B0V2N1	0.339	0.340	0.000	1907	0.704	0.706	B0V2N1.pdb.gz	PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1
5	AFDB:F1NWE3	0.386	0.464	0.000	1516	0.599	0.756	F1NWE3.pdb.gz	PTPRS_CHICK Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3
6	AFDB:F1QJW2	0.324	0.323	0.000	1918	0.674	0.672	F1QJW2.pdb.gz
7	AFDB:P10586	0.318	0.319	0.000	1907	0.692	0.694	P10586.pdb.gz	PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2
8	AFDB:P16621	0.318	0.300	0.000	2029	0.503	0.474	P16621.pdb.gz	LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2
9	AFDB:P23468	1.000	1.000	0.000	1912	1.000	1.000	P23468.pdb.gz	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2
10	AFDB:Q13332	0.328	0.322	0.000	1948	0.724	0.711	Q13332.pdb.gz	PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens OX=9606 GN=PTPRS PE=1 SV=3
11	PDB:4gwfA	0.142	0.534	1.790E-24	497	0.059	0.225	4gwfA.pdb.gz
12	PDB:5xzrA	0.142	0.511	6.005E-24	519	0.060	0.220	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
13	PDB:3ps5A	0.148	0.523	6.615E-24	529	0.056	0.204	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
14	PDB:5oj2B	0.072	0.161	2.267E-22	692	0.061	0.168	5oj2B.pdb.gz
15	PDB:6krwA	0.138	0.811	2.254E-20	306	0.046	0.284	6krwA.pdb.gz
16	PDB:1e07A	0.106	0.189	2.997E-18	642	0.044	0.132	1e07A.pdb.gz
17	PDB:5a42A	0.075	0.084	3.145E-18	1597	0.053	0.063	5a42A.pdb.gz
18	PDB:7q5zA	0.077	0.097	2.455E-16	1344	0.055	0.079	7q5zA.pdb.gz
19	PDB:7sqcO0	0.085	0.121	6.785E-16	1140	0.050	0.084	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:6h03A	0.064	0.085	2.763E-15	1223	0.046	0.072	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZQN2	1204	1506	0.313	0.398	A0A8I5ZQN2_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
2	A0A8I6A1V1	3910	1912	0.979	0.979	A0A8I6A1V1_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
3	A0A8I6A6R5	3857	1920	0.972	0.968	A0A8I6A6R5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
4	A0A8I6A789	1170	1505	0.308	0.391	A0A8I6A789_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
5	A0A8I6AEM0	3842	1897	0.968	0.976	A0A8I6AEM0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
6	A2A8L5	2704	1898	0.697	0.702	PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus OX=10090 GN=Ptprf PE=1 SV=1
7	A4IFW2	2716	1909	0.690	0.691	PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1
8	B0V2N1	2779	1907	0.707	0.708	PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1
9	B2GV87	566	699	0.152	0.416	PTPRE_RAT Receptor-type tyrosine-protein phosphatase epsilon OS=Rattus norvegicus OX=10116 GN=Ptpre PE=2 SV=1
10	F1NWE3	1585	1516	0.416	0.524	PTPRS_CHICK Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3
11	F1QE38	600	831	0.150	0.345	F1QE38_DANRE Receptor-type tyrosine-protein phosphatase alpha OS=Danio rerio OX=7955 GN=RPTP[a] PE=1 SV=1
12	G5EDC5	767	2009	0.179	0.170	G5EDC5_CAEEL protein-tyrosine-phosphatase OS=Caenorhabditis elegans OX=6239 GN=ptp-3 PE=1 SV=2
13	G5EE54	815	1985	0.329	0.317	G5EE54_CAEEL protein-tyrosine-phosphatase OS=Caenorhabditis elegans OX=6239 GN=ptp-3 PE=1 SV=1
14	H9CWQ2	2648	1894	0.679	0.686	H9CWQ2_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=LAR PE=2 SV=1
15	M0RB22	3840	1899	0.965	0.972	M0RB22_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=3
16	P10586	2707	1907	0.698	0.700	PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2
17	P16621	1233	2029	0.372	0.351	LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2
18	P18052	601	829	0.171	0.394	PTPRA_MOUSE Receptor-type tyrosine-protein phosphatase alpha OS=Mus musculus OX=10090 GN=Ptpra PE=1 SV=3
19	P18433	619	802	0.158	0.378	PTPRA_HUMAN Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens OX=9606 GN=PTPRA PE=1 SV=3
20	P23468	3976	1912	1.000	1.000	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17425 Arylsulfotran_N	3e+02	12.8	Arylsulfotransferase Ig-like domain
2	PF08205 C2-set_2	1.2	20.5	CD80-like C2-set immunoglobulin domain
3	PF00782 DSPc	0.00012	33.4	Dual specificity phosphatase, catalytic domain
4	PF11948 DUF3465	1.8e+02	13.4	Protein of unknown function (DUF3465)
5	PF19167 DUF5849	66	14.7	Family of unknown function (DUF5849)
6	PF00041 fn3	4.2e-115	387.7	Fibronectin type III domain
7	PF16893 fn3_2	2.7e-08	45.2	Fibronectin type III domain
8	PF16794 fn3_4	13	17.1	Fibronectin-III type domain
9	PF16874 Glyco_hydro_36C	2.4e+02	13.5	Glycosyl hydrolase family 36 C-terminal domain
10	PF01374 Glyco_hydro_46	4e+02	12.0	Glycosyl hydrolase family 46
11	PF07679 I-set	2.9e-35	131.5	Immunoglobulin I-set domain
12	PF00047 ig	1.5e-10	52.4	Immunoglobulin domain
13	PF13895 Ig_2	1.5e-15	68.6	Immunoglobulin domain
14	PF13927 Ig_3	6.1e-35	130.9	Immunoglobulin domain
15	PF17736 Ig_C17orf99	0.067	24.6	C17orf99 Ig domain
16	PF09294 Interfer-bind	6.9e-05	34.4	Interferon-alpha/beta receptor, fibronectin type III
17	PF10179 NDNF	0.025	26.1	Neuron-derived neurotrophic factor, first Fn(III) domain
18	PF14566 PTPlike_phytase	0.028	26.0	Inositol hexakisphosphate
19	PF18861 PTP_tm	52	15.6	TM proximal of protein tyrosine phosphatase, receptor type J
20	PF16656 Pur_ac_phosph_N	5.6e-17	73.5	Purple acid Phosphatase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370593

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366288	0.992	SLIT and NTRK-like protein 1
2	9606.ENSP00000368278	0.989	Interleukin-1 receptor accessory protein-like 1
3	9606.ENSP00000420091	0.984	SLIT and NTRK-like protein 3
4	9606.ENSP00000253925	0.966	Liprin-alpha-1
5	9606.ENSP00000335614	0.962	Liprin-alpha-3
6	9606.ENSP00000298119	0.954	Leucine-rich repeat and fibronectin type-III domain-containing protein 5
7	9606.ENSP00000450337	0.884	Liprin-alpha-2
8	9606.ENSP00000314807	0.883	Interleukin 1 receptor accessory protein
9	9606.ENSP00000471502	0.871	Leucine-rich repeat-containing protein 4B
10	9606.ENSP00000299492	0.867	Liprin-beta-2
11	9606.ENSP00000314724	0.866	Liprin-beta-1
12	9606.ENSP00000272198	0.834	Liprin-alpha-4
13	9606.ENSP00000366283	0.783	SLIT and NTRK-like protein 5
14	9606.ENSP00000248668	0.782	Leucine-rich repeat and fibronectin type III domain-containing protein 1
15	9606.ENSP00000359864	0.745	Glypican-4
16	9606.ENSP00000418751	0.736	BTB/POZ domain-containing protein 9
17	9606.ENSP00000359521	0.734	SLIT and NTRK-like protein 2
18	9606.ENSP00000219746	0.733	TOX high mobility group box family member 3
19	9606.ENSP00000178640	0.731	Dual specificity mitogen-activated protein kinase kinase 5
20	9606.ENSP00000312535	0.715	Leucine-rich repeat and fibronectin type-III domain-containing protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005001	0.998	transmembrane receptor protein tyrosine phosphatase activity
GO:0050839	0.708	cell adhesion molecule binding
GO:0005102	0.697	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0051128	0.985	regulation of cellular component organization
GO:1902115	0.979	regulation of organelle assembly
GO:0099175	0.979	regulation of postsynapse organization
GO:1901888	0.970	regulation of cell junction assembly
GO:0098742	0.958	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0051963	0.955	regulation of synapse assembly
GO:0034330	0.936	cell junction organization
GO:0050808	0.897	synapse organization
GO:0032501	0.573	multicellular organismal process
GO:0008152	0.444	metabolic process
GO:0050896	0.423	response to stimulus
GO:0032502	0.399	developmental process
GO:0048856	0.391	anatomical structure development
GO:0007275	0.311	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0030054	0.992	cell junction
GO:0045202	0.977	synapse
GO:0098978	0.965	glutamatergic synapse
GO:0071944	0.795	cell periphery
GO:0005886	0.794	plasma membrane
GO:0043226	0.751	organelle
GO:0005622	0.713	intracellular anatomical structure
GO:0043227	0.688	membrane-bounded organelle
GO:0005737	0.636	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	0.999	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.999	protein-tyrosine-phosphatase.

[back to server]