StarFunc result for job id P23471

User Input

>input (2315 residues)
MRILKRFLACIQLLCVCRLDWANGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPTCNSPK
QSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMV
FKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALS
ILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPC
TDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
TGKEEIHEAVCSSEPENVQADPENYTSLLVTWERPRVVYDTMIEKFAVLYQQLDGEDQTK
HEFLTDGYQDLGAILNNLLPNMSYVLQIVAICTNGLYGKYSDQLIVDMPTDNPELDLFPE
LIGTEEIIKEEEEGKDIEEGAIVNPGRDSATNQIRKKEPQISTTTHYNRIGTKYNEAKTN
RSPTRGSEFSGKGDVPNTSLNSTSQPVTKLATEKDISLTSQTVTELPPHTVEGTSASLND
GSKTVLRSPHMNLSGTAESLNTVSITEYEEESLLTSFKLDTGAEDSSGSSPATSAIPFIS
ENISQGYIFSSENPETITYDVLIPESARNASEDSTSSGSEESLKDPSMEGNVWFPSSTDI
TAQPDVGSGRESFLQTNYTEIRVDESEKTTKSFSAGPVMSQGPSVTDLEMPHYSTFAYFP
TEVTPHAFTPSSRQQDLVSTVNVVYSQTTQPVYNGETPLQPSYSSEVFPLVTPLLLDNQI
LNTTPAASSSDSALHATPVFPSVDVSFESILSSYDGAPLLPFSSASFSSELFRHLHTVSQ
ILPQVTSATESDKVPLHASLPVAGGDLLLEPSLAQYSDVLSTTHAASETLEFGSESGVLY
KTLMFSQVEPPSSDAMMHARSSGPEPSYALSDNEGSQHIFTVSYSSAIPVHDSVGVTYQG
SLFSGPSHIPIPKSSLITPTASLLQPTHALSGDGEWSGASSDSEFLLPDTDGLTALNISS
PVSVAEFTYTTSVFGDDNKALSKSEIIYGNETELQIPSFNEMVYPSESTVMPNMYDNVNK
LNASLQETSVSISSTKGMFPGSLAHTTTKVFDHEISQVPENNFSVQPTHTVSQASGDTSL
KPVLSANSEPASSDPASSEMLSPSTQLLFYETSASFSTEVLLQPSFQASDVDTLLKTVLP
AVPSDPILVETPKVDKISSTMLHLIVSNSASSENMLHSTSVPVFDVSPTSHMHSASLQGL
TISYASEKYEPVLLKSESSHQVVPSLYSNDELFQTANLEINQAHPPKGRHVFATPVLSID
EPLNTLINKLIHSDEILTSTKSSVTGKVFAGIPTVASDTFVSTDHSVPIGNGHVAITAVS
PHRDGSVTSTKLLFPSKATSELSHSAKSDAGLVGGGEDGDTDDDGDDDDDDRGSDGLSIH
KCMSCSSYRESQEKVMNDSDTHENSLMDQNNPISYSLSENSEEDNRVTSVSSDSQTGMDR
SPGKSPSANGLSQKHNDGKEENDIQTGSALLPLSPESKAWAVLTSDEESGSGQGTSDSLN
ENETSTDFSFADTNEKDADGILAAGDSEITPGFPQSPTSSVTSENSEVFHVSEAEASNSS
HESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYLEDSTSPR
VISTPPTPIFPISDDVGAIPIKHFPKHVADLHASSGFTEEFETLKEFYQEVQSCTVDLGI
TADSSNHPDNKHKNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAA
QGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQ
VLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAAY
AKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEE
QYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPAGKTKLEKQFQLLSQSNIQQSDY
SAALKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMGYYQSNEFIITQHPLL
HTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESFKVTLMAEEHKCLS
NEEKLIIQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPMI
VHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKVIL
SLVSTRQEENPSTSLDSNGAALPDGNIAESLESLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23471	1.000	1.000	0.000	2315	1.000	1.000	P23471.pdb.gz	PTPRZ_HUMAN Receptor-type tyrosine-protein phosphatase zeta OS=Homo sapiens OX=9606 GN=PTPRZ1 PE=1 SV=4
2	AFDB:Q62656	0.378	0.378	0.000	2316	0.819	0.819	Q62656.pdb.gz	PTPRZ_RAT Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus OX=10116 GN=Ptprz1 PE=1 SV=1
3	AFDB:A0A0B5JSB3	0.151	0.471	6.757E-61	624	0.118	0.439	A0A0B5JSB3.pdb.gz
4	AFDB:A0A0B5JFF8	0.131	0.662	2.431E-58	416	0.100	0.555	A0A0B5JFF8.pdb.gz
5	PDB:5xzrA	0.119	0.509	1.179E-25	519	0.050	0.224	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
6	PDB:4gwfA	0.117	0.527	3.373E-25	497	0.049	0.229	4gwfA.pdb.gz
7	PDB:3ps5A	0.117	0.491	1.335E-23	529	0.048	0.208	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
8	PDB:6nj4A	0.108	0.890	2.644E-23	265	0.034	0.294	6nj4A.pdb.gz	Immobilization of Proteins with Controlled Load and Orientation.
9	PDB:3ml5A	0.107	0.888	3.095E-23	262	0.035	0.313	3ml5A.pdb.gz	Crystal structure of the C183S/C217S mutant of human CA VII in complex with acetazolamide
10	PDB:1z93A	0.106	0.862	1.151E-22	263	0.030	0.262	1z93A.pdb.gz	Human Carbonic Anhydrase III: Structural and Kinetic Study of Catalysis and Proton Transfer
11	PDB:5jn8C	0.102	0.830	1.151E-22	264	0.032	0.284	5jn8C.pdb.gz	Intrinsic thermodynamics of high affinity inhibitor binding to recombinant human carbonic anhydrase IV.
12	PDB:3d0nA	0.104	0.869	1.497E-22	263	0.034	0.300	3d0nA.pdb.gz	Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide.
13	PDB:3fe4B	0.101	0.903	2.669E-22	245	0.031	0.294	3fe4B.pdb.gz	Crystal structure of the secretory isozyme of mammalian carbonic anhydrases CA VI: implications for biological assembly and inhibitor development
14	PDB:1bzmA	0.106	0.883	6.188E-22	260	0.034	0.300	1bzmA.pdb.gz	Drug-protein interactions. Refined structures of three sulfonamide drug complexes of human carbonic anhydrase I enzyme.
15	AFDB:Q9VUH6	0.113	0.140	4.331E-14	1833	0.084	0.106	Q9VUH6.pdb.gz	Q9VUH6_DROME Myopic OS=Drosophila melanogaster OX=7227 GN=mop PE=1 SV=2
16	AFDB:Q9W2F3	0.099	0.159	7.720E-14	1377	0.098	0.164	Q9W2F3.pdb.gz	Q9W2F3_DROME Protein tyrosine phosphatase ERK OS=Drosophila melanogaster OX=7227 GN=PTP-ER PE=2 SV=2
17	AFDB:Q4ZHG4	0.050	0.060	6.500E-10	1894	0.087	0.106	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
18	AFDB:Q2Q0I9	0.060	0.071	8.453E-10	1779	0.079	0.102	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
19	AFDB:O55005	0.052	0.068	1.443E-8	1651	0.070	0.098	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
20	AFDB:A0A0G2JZA1	0.048	0.070	6.625E-8	1512	0.062	0.095	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K561	0.0	1039	1341	0.209	0.361	A0A0G2K561_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprg PE=1 SV=2
2	A0A8I6A6D9	0.0	1038	1413	0.209	0.343	A0A8I6A6D9_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprg PE=1 SV=1
3	A0A8I6ARJ1	0.0	991	667	0.199	0.691	A0A8I6ARJ1_RAT Protein tyrosine phosphatase, receptor type, G OS=Rattus norvegicus OX=10116 GN=Ptprg PE=1 SV=1
4	B9EKR1	0.0	3799	2312	0.819	0.820	PTPRZ_MOUSE Receptor-type tyrosine-protein phosphatase zeta OS=Mus musculus OX=10090 GN=Ptprz1 PE=1 SV=1
5	F1LP13	0.0	1023	1442	0.209	0.336	F1LP13_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprg PE=1 SV=4
6	P23470	0.0	1025	1445	0.209	0.334	PTPRG_HUMAN Receptor-type tyrosine-protein phosphatase gamma OS=Homo sapiens OX=9606 GN=PTPRG PE=1 SV=4
7	P23471	0.0	4781	2315	1.000	1.000	PTPRZ_HUMAN Receptor-type tyrosine-protein phosphatase zeta OS=Homo sapiens OX=9606 GN=PTPRZ1 PE=1 SV=4
8	Q05909	0.0	1022	1442	0.208	0.334	PTPRG_MOUSE Receptor-type tyrosine-protein phosphatase gamma OS=Mus musculus OX=10090 GN=Ptprg PE=1 SV=1
9	Q62656	0.0	3783	2316	0.820	0.820	PTPRZ_RAT Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus OX=10116 GN=Ptprz1 PE=1 SV=1
10	Q8CIN3	0.0	981	1426	0.204	0.332	Q8CIN3_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprg PE=2 SV=1
11	P35832	1.38e-167	555	1301	0.122	0.218	PTP99_DROME Tyrosine-protein phosphatase 99A OS=Drosophila melanogaster OX=7227 GN=Ptp99A PE=2 SV=2
12	Q16K62	2.55e-158	517	936	0.115	0.284	Q16K62_AEDAE protein-tyrosine-phosphatase OS=Aedes aegypti OX=7159 GN=AAEL013105 PE=1 SV=1
13	Q64604	1.42e-128	452	1898	0.105	0.129	PTPRF_RAT Receptor-type tyrosine-protein phosphatase F OS=Rattus norvegicus OX=10116 GN=Ptprf PE=2 SV=1
14	A0A8I6A789	3.51e-128	445	1505	0.113	0.174	A0A8I6A789_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
15	A2A8L5	1.17e-127	449	1898	0.105	0.128	PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus OX=10090 GN=Ptprf PE=1 SV=1
16	A0A8I5ZQN2	2.61e-127	442	1506	0.105	0.162	A0A8I5ZQN2_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
17	M0RB22	1.19e-126	446	1899	0.113	0.138	M0RB22_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=3
18	A0A8I6A6R5	1.77e-126	446	1920	0.113	0.136	A0A8I6A6R5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
19	Q64487	5.23e-126	444	1912	0.110	0.133	PTPRD_MOUSE Receptor-type tyrosine-protein phosphatase delta OS=Mus musculus OX=10090 GN=Ptprd PE=1 SV=3
20	A0A8I6AEM0	6.17e-126	444	1897	0.110	0.134	A0A8I6AEM0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00194 Carb_anhydrase	8.9e-65	230.5	Eukaryotic-type carbonic anhydrase
2	PF00782 DSPc	2.1	19.6	Dual specificity phosphatase, catalytic domain
3	PF00041 fn3	3.5e-09	48.2	Fibronectin type III domain
4	PF06024 Orf78	2.6e+02	13.3	Orf78 (ac78)
5	PF01640 Peptidase_C10	61	15.4	Peptidase C10 family
6	PF14566 PTPlike_phytase	3.4e+02	12.7	Inositol hexakisphosphate
7	PF00102 Y_phosphatase	1.3e-140	478.3	Protein-tyrosine phosphatase
8	PF13350 Y_phosphatase3	13	17.2	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377047

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000447006	0.998	Contactin-1
2	9606.ENSP00000341170	0.997	Pleiotrophin
3	9606.ENSP00000397863	0.995	Interleukin-34
4	9606.ENSP00000385451	0.964	Midkine
5	9606.ENSP00000342235	0.957	Receptor tyrosine-protein kinase erbB-4
6	9606.ENSP00000252575	0.923	Neurocan core protein
7	9606.ENSP00000480132	0.898	Neural cell adhesion molecule 1
8	9606.ENSP00000368314	0.878	Neuronal cell adhesion molecule
9	9606.ENSP00000331210	0.876	Brevican core protein
10	9606.ENSP00000373700	0.863	ALK tyrosine kinase receptor
11	9606.ENSP00000382428	0.816	Disks large homolog 4
12	9606.ENSP00000256509	0.809	Neural cell adhesion molecule L1-like protein
13	9606.ENSP00000261023	0.789	Integrin alpha-V
14	9606.ENSP00000265077	0.778	Versican core protein
15	9606.ENSP00000419124	0.778	Protein FAM107A
16	9606.ENSP00000264638	0.739	Contactin-associated protein 1
17	9606.ENSP00000330633	0.733	Contactin-2
18	9606.ENSP00000261349	0.721	Low-density lipoprotein receptor-related protein 6
19	9606.ENSP00000351475	0.705	PAS domain-containing serine/threonine-protein kinase
20	9606.ENSP00000387356	0.703	Aggrecan core protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0005001	0.976	transmembrane receptor protein tyrosine phosphatase activity
GO:0005102	0.920	signaling receptor binding
GO:0050839	0.906	cell adhesion molecule binding
GO:0044877	0.876	protein-containing complex binding
GO:0005178	0.865	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006796	0.990	phosphate-containing compound metabolic process
GO:0036211	0.990	protein modification process
GO:0006470	0.981	protein dephosphorylation
GO:0065007	0.977	biological regulation
GO:0050794	0.968	regulation of cellular process
GO:0007399	0.956	nervous system development
GO:0050896	0.765	response to stimulus
GO:0007417	0.756	central nervous system development
GO:0048519	0.631	negative regulation of biological process
GO:0048523	0.555	negative regulation of cellular process
GO:0048518	0.553	positive regulation of biological process
GO:0048522	0.486	positive regulation of cellular process
GO:0019222	0.436	regulation of metabolic process
GO:0060255	0.410	regulation of macromolecule metabolic process
GO:0080090	0.400	regulation of primary metabolic process
GO:0051171	0.399	regulation of nitrogen compound metabolic process
GO:0031323	0.361	regulation of cellular metabolic process
GO:0071840	0.356	cellular component organization or biogenesis
GO:0016043	0.326	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.835	intracellular anatomical structure
GO:0043226	0.800	organelle
GO:0005737	0.749	cytoplasm
GO:0030054	0.639	cell junction
GO:0045202	0.384	synapse
GO:0043231	0.381	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]