StarFunc result for job id P23497

User Input

>input (879 residues)
MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRN
KVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRNLVPVQRVVYNVLSELEKTFNLP
VLEALFSDVNMQEYPDLIHIYKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENS
FRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQ
KAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK
PFSNSKVECQAQARTHHNQASDIIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPL
ESNDEKEGQEATCSRPQIVPEPMDFRKLSTFRESFKKRVIGQDHDFSESSEEEAPAEASS
GALRSKHGEKAPMTSRSTSTWRIPSRKRRFSSSDFSDLSNGEELQETCSSSLRRGSGSQP
QEPENKKCSCVMCFPKGVPRSQEARTESSQASDMMDTMDVENNSTLEKHSGKRRKKRRHR
SKVNGLQRGRKKDRPRKHLTLNNKVQKKRWQQRGRKANTRPLKRRRKRGPRIPKDENINF
KQSELPVTCGEVKGTLYKERFKQGTSKKCIQSEDKKWFTPREFEIEGDRGASKNWKLSIR
CGGYTLKVLMENKFLPEPPSTRKKRILESHNNTLVDPCEEHKKKNPDASVKFSEFLKKCS
ETWKTIFAKEKGKFEDMAKADKAHYEREMKTYIPPKGEKKKKFKDPNAPKRPPLAFFLFC
SEYRPKIKGEHPGLSIDDVVKKLAGMWNNTAAADKQFYEKKAAKLKEKYKKDIAAYRAKG
KPNSAKKRVVKAEKSKKKKEEEEDEEDEQEEENEEDDDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23497	1.000	1.000	0.000	879	1.000	1.000	P23497.pdb.gz	SP100_HUMAN Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100 PE=1 SV=3
2	AFDB:Q13342	0.146	0.148	2.870E-31	867	0.282	0.286	Q13342.pdb.gz	SP140_HUMAN Nuclear body protein SP140 OS=Homo sapiens OX=9606 GN=SP140 PE=1 SV=2
3	AFDB:Q9HB58	0.125	0.159	4.433E-19	689	0.222	0.283	Q9HB58.pdb.gz	SP110_HUMAN Sp110 nuclear body protein OS=Homo sapiens OX=9606 GN=SP110 PE=1 SV=5
4	AFDB:Q8BVK9	0.123	0.240	8.525E-19	445	0.174	0.344	Q8BVK9.pdb.gz	SP110_MOUSE Sp110 nuclear body protein OS=Mus musculus OX=10090 GN=Sp110 PE=1 SV=1
5	PDB:1j5nA	0.087	0.688	2.034E-3	93	0.038	0.355	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
6	AFDB:C7C1L8	0.092	0.129	1.901E-1	585	0.088	0.132	C7C1L8.pdb.gz
7	AFDB:F1S8C6	0.094	0.145	2.120E-1	532	0.085	0.141	F1S8C6.pdb.gz
8	AFDB:P16157	0.080	0.048	2.636E-1	1881	0.082	0.038	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
9	AFDB:A0ZVR1	0.094	0.146	3.105E-1	524	0.090	0.151	A0ZVR1.pdb.gz	A0ZVR1_PIG Mitochondrial antiviral signaling protein OS=Sus scrofa OX=9823 GN=Mavs PE=2 SV=1
10	AFDB:Q6FTP4	0.048	0.054	3.462E-1	722	0.105	0.127	Q6FTP4.pdb.gz	Q6FTP4_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G00902g PE=4 SV=1
11	AFDB:Q9LE42	0.042	0.036	4.305E-1	1670	0.089	0.047	Q9LE42.pdb.gz	HAC5_ARATH Histone acetyltransferase HAC5 OS=Arabidopsis thaliana OX=3702 GN=HAC5 PE=2 SV=1
12	PDB:4ikmA	0.092	0.168	1.195	463	0.022	0.041	4ikmA.pdb.gz	The structure of the CARD8 caspase-recruitment domain suggests its association with the FIIND domain and procaspases through adjacent surfaces.
13	PDB:4irlB	0.095	0.172	1.569	463	0.015	0.028	4irlB.pdb.gz	Structure of the caspase-recruitment domain from a zebrafish guanylate-binding protein.
14	PDB:6c0fD	0.042	0.129	2.298	190	0.019	0.089	6c0fD.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
15	PDB:7nsuD	0.048	0.089	2.563	420	0.017	0.036	7nsuD.pdb.gz
16	PDB:6ybwz	0.085	0.274	2.707	160	0.016	0.087	6ybwz.pdb.gz	Structure of a human 48Stranslational initiation complex.
17	PDB:7ploI	0.055	0.106	2.707	451	0.011	0.022	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
18	PDB:3geiC	0.042	0.095	3.018	298	0.018	0.054	3geiC.pdb.gz
19	PDB:6zm7CE	0.044	0.297	3.187	124	0.018	0.129	6zm7CE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
20	PDB:4zzlA	0.059	0.232	3.554	146	0.024	0.144	4zzlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PHV6	0.0	920	455	0.514	0.993	E9PHV6_HUMAN SP100 nuclear antigen OS=Homo sapiens OX=9606 GN=SP100 PE=1 SV=1
2	P23497	0.0	1815	879	1.000	1.000	SP100_HUMAN Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100 PE=1 SV=3
3	F2Z594	4.69e-76	249	220	0.159	0.636	F2Z594_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
4	P09429	6.67e-75	245	215	0.157	0.642	HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3
5	P10103	6.67e-75	245	215	0.157	0.642	HMGB1_BOVIN High mobility group protein B1 OS=Bos taurus OX=9913 GN=HMGB1 PE=1 SV=3
6	P63158	6.67e-75	245	215	0.157	0.642	HMGB1_MOUSE High mobility group protein B1 OS=Mus musculus OX=10090 GN=Hmgb1 PE=1 SV=2
7	P63159	6.67e-75	245	215	0.157	0.642	HMGB1_RAT High mobility group protein B1 OS=Rattus norvegicus OX=10116 GN=Hmgb1 PE=1 SV=2
8	P12682	5.20e-74	243	215	0.156	0.637	HMGB1_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
9	Q9YH06	1.22e-68	228	215	0.147	0.600	HMGB1_CHICK High mobility group protein B1 OS=Gallus gallus OX=9031 GN=HMGB1 PE=1 SV=1
10	P07746	4.65e-64	216	204	0.119	0.515	HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
11	F1NPU8	1.28e-62	212	207	0.132	0.560	F1NPU8_CHICK High mobility group box 2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=1 SV=1
12	P26584	3.31e-62	211	207	0.132	0.560	HMGB2_CHICK High mobility group protein B2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=2 SV=2
13	Q6NX86	3.85e-61	207	205	0.130	0.556	Q6NX86_DANRE High mobility group box 1a OS=Danio rerio OX=7955 GN=HMGB1 PE=1 SV=1
14	Q5U071	7.66e-60	204	208	0.135	0.572	Q5U071_HUMAN High-mobility group box 2 OS=Homo sapiens OX=9606 PE=2 SV=1
15	P26583	7.91e-60	204	209	0.135	0.569	HMGB2_HUMAN High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2
16	P40673	7.91e-60	204	209	0.135	0.569	HMGB2_BOVIN High mobility group protein B2 OS=Bos taurus OX=9913 GN=HMGB2 PE=1 SV=3
17	P52925	7.04e-59	202	210	0.134	0.562	HMGB2_RAT High mobility group protein B2 OS=Rattus norvegicus OX=10116 GN=Hmgb2 PE=2 SV=2
18	P30681	3.77e-58	200	210	0.134	0.562	HMGB2_MOUSE High mobility group protein B2 OS=Mus musculus OX=10090 GN=Hmgb2 PE=1 SV=3
19	Q3U566	3.77e-58	200	210	0.134	0.562	Q3U566_MOUSE HMG box domain-containing protein OS=Mus musculus OX=10090 GN=Hmgb2 PE=2 SV=1
20	Q13342	1.33e-56	212	867	0.163	0.165	SP140_HUMAN Nuclear body protein SP140 OS=Homo sapiens OX=9606 GN=SP140 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	3.4e-25	99.6	HMG (high mobility group) box
2	PF09011 HMG_box_2	1.6e-23	94.3	HMG-box domain
3	PF03172 HSR	1.8e-41	151.6	HSR domain
4	PF01342 SAND	2.1e-29	112.4	SAND domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000006583

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000011350	0.952	Ubiquitin-conjugating enzyme E2I
2	9593.ENSGGOP00000017745	0.951	Promyelocytic leukemia
3	9593.ENSGGOP00000023832	0.951	Small ubiquitin-like modifier 1
4	9593.ENSGGOP00000025737	0.899	Death-domain associated protein
5	9593.ENSGGOP00000002214	0.859	SPT16 homolog, facilitates chromatin remodeling subunit
6	9593.ENSGGOP00000009561	0.842	Cellular tumor antigen p53
7	9593.ENSGGOP00000017359	0.829	Nucleoporin 210kDa
8	9593.ENSGGOP00000009434	0.827	Heat shock 70kDa protein 4
9	9593.ENSGGOP00000000040	0.820	Chromobox homolog 5
10	9593.ENSGGOP00000003605	0.759	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
11	9593.ENSGGOP00000011962	0.754	Uncharacterized protein
12	9593.ENSGGOP00000016811	0.749	Small ubiquitin-related modifier
13	9593.ENSGGOP00000018715	0.749	Small ubiquitin-related modifier
14	9593.ENSGGOP00000020268	0.749	Small ubiquitin-related modifier
15	9593.ENSGGOP00000028373	0.749	Small ubiquitin-related modifier
16	9593.ENSGGOP00000005899	0.731	CREB binding protein
17	9593.ENSGGOP00000002806	0.724	ETS proto-oncogene 1, transcription factor
18	9593.ENSGGOP00000025404	0.718	ATRX, chromatin remodeler
19	9593.ENSGGOP00000024256	0.709	Small ubiquitin-like modifier 3
20	9593.ENSGGOP00000024096	0.697	ATP-dependent Clp protease proteolytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140110	0.999	transcription regulator activity
GO:0019899	0.997	enzyme binding
GO:0046983	0.993	protein dimerization activity
GO:0003677	0.986	DNA binding
GO:0000981	0.984	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0042802	0.980	identical protein binding
GO:0008134	0.971	transcription factor binding
GO:0061629	0.933	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0019904	0.927	protein domain specific binding
GO:0019900	0.924	kinase binding
GO:0042803	0.924	protein homodimerization activity
GO:0070087	0.554	chromo shadow domain binding
GO:0000976	0.317	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0009987	0.984	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0048518	0.981	positive regulation of biological process
GO:0065009	0.980	regulation of molecular function
GO:0006950	0.979	response to stress
GO:0098542	0.969	defense response to other organism
GO:0048519	0.967	negative regulation of biological process
GO:0006357	0.967	regulation of transcription by RNA polymerase II
GO:0048523	0.958	negative regulation of cellular process
GO:0045893	0.936	positive regulation of DNA-templated transcription
GO:0051716	0.934	cellular response to stimulus
GO:0008152	0.925	metabolic process
GO:0071840	0.919	cellular component organization or biogenesis
GO:0044260	0.919	cellular macromolecule metabolic process
GO:0044238	0.911	primary metabolic process
GO:0006996	0.905	organelle organization
GO:0006807	0.901	nitrogen compound metabolic process
GO:0031327	0.885	negative regulation of cellular biosynthetic process
GO:0048583	0.876	regulation of response to stimulus
GO:0010558	0.872	negative regulation of macromolecule biosynthetic process
GO:0051179	0.870	localization
GO:0051276	0.796	chromosome organization
GO:0008104	0.792	protein localization
GO:0042221	0.791	response to chemical
GO:0051098	0.760	regulation of binding
GO:0045892	0.759	negative regulation of DNA-templated transcription
GO:0033365	0.748	protein localization to organelle
GO:0032879	0.726	regulation of localization
GO:0006955	0.652	immune response
GO:0044093	0.593	positive regulation of molecular function
GO:0007154	0.578	cell communication
GO:0023052	0.544	signaling
GO:0072595	0.525	maintenance of protein localization in organelle
GO:0070887	0.524	cellular response to chemical stimulus
GO:0050792	0.516	regulation of viral process
GO:0045087	0.510	innate immune response
GO:0010033	0.508	response to organic substance
GO:0007165	0.505	signal transduction
GO:0033554	0.494	cellular response to stress
GO:0045944	0.448	positive regulation of transcription by RNA polymerase II
GO:0034504	0.444	protein localization to nucleus
GO:0071310	0.413	cellular response to organic substance
GO:0000122	0.402	negative regulation of transcription by RNA polymerase II
GO:0023051	0.394	regulation of signaling
GO:0010646	0.393	regulation of cell communication
GO:0009966	0.381	regulation of signal transduction
GO:0034097	0.361	response to cytokine
GO:0050793	0.358	regulation of developmental process
GO:0090304	0.356	nucleic acid metabolic process
GO:0060341	0.344	regulation of cellular localization
GO:0042981	0.342	regulation of apoptotic process
GO:0051239	0.335	regulation of multicellular organismal process
GO:0051101	0.333	regulation of DNA binding
GO:0006974	0.311	cellular response to DNA damage stimulus
GO:0050790	0.303	regulation of catalytic activity
GO:0051049	0.301	regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0032991	0.996	protein-containing complex
GO:0005694	0.984	chromosome
GO:0016604	0.961	nuclear body
GO:0005737	0.903	cytoplasm
GO:0005730	0.725	nucleolus
GO:0034399	0.650	nuclear periphery
GO:0098687	0.627	chromosomal region
GO:0016605	0.624	PML body
GO:0000781	0.574	chromosome, telomeric region
GO:0140513	0.438	nuclear protein-containing complex
GO:0030870	0.361	Mre11 complex
GO:0000785	0.335	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]