StarFunc result for job id P23510

User Input

>input (183 residues)
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQ
SIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQ
KDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEF
CVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23510	1.000	1.000	9.123E-32	183	1.000	1.000	P23510.pdb.gz	TNFL4_HUMAN Tumor necrosis factor ligand superfamily member 4 OS=Homo sapiens OX=9606 GN=TNFSF4 PE=1 SV=1
2	AFDB:P43488	0.615	0.572	3.732E-16	198	0.432	0.399	P43488.pdb.gz	TNFL4_MOUSE Tumor necrosis factor ligand superfamily member 4 OS=Mus musculus OX=10090 GN=Tnfsf4 PE=1 SV=1
3	AFDB:Q9Z2P3	0.616	0.569	1.239E-15	199	0.448	0.412	Q9Z2P3.pdb.gz	TNFL4_RAT Tumor necrosis factor ligand superfamily member 4 OS=Rattus norvegicus OX=10116 GN=Tnfsf4 PE=2 SV=1
4	AFDB:P32970	0.552	0.530	5.321E-7	193	0.131	0.124	P32970.pdb.gz	CD70_HUMAN CD70 antigen OS=Homo sapiens OX=9606 GN=CD70 PE=1 SV=2
5	AFDB:Q08CQ3	0.502	0.416	8.077E-7	234	0.148	0.115	Q08CQ3.pdb.gz	Q08CQ3_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=2 SV=1
6	AFDB:O95150	0.423	0.318	1.591E-6	251	0.219	0.159	O95150.pdb.gz	TNF15_HUMAN Tumor necrosis factor ligand superfamily member 15 OS=Homo sapiens OX=9606 GN=TNFSF15 PE=1 SV=2
7	AFDB:Q4W897	0.481	0.439	1.766E-6	203	0.175	0.158	Q4W897.pdb.gz	Q4W897_DANRE Lymphotoxin alpha OS=Danio rerio OX=7955 GN=TNF-N PE=2 SV=1
8	AFDB:P41047	0.471	0.327	2.176E-6	279	0.208	0.136	P41047.pdb.gz	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
9	AFDB:Q7TS55	0.484	0.506	2.545E-6	173	0.180	0.191	Q7TS55.pdb.gz	TNF18_MOUSE Tumor necrosis factor ligand superfamily member 18 OS=Mus musculus OX=10090 GN=Tnfsf18 PE=1 SV=1
10	AFDB:P32972	0.436	0.341	2.825E-6	239	0.153	0.117	P32972.pdb.gz	TNFL8_MOUSE Tumor necrosis factor ligand superfamily member 8 OS=Mus musculus OX=10090 GN=Tnfsf8 PE=2 SV=1
11	PDB:7bhqB	0.209	0.191	4.044E-4	204	0.104	0.093	7bhqB.pdb.gz
12	PDB:7e57B	0.400	0.569	7.180E-4	123	0.093	0.138	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
13	PDB:5h4bA	0.482	0.623	1.490E-3	136	0.082	0.110	5h4bA.pdb.gz
14	PDB:5kc6B	0.446	0.546	9.255E-3	144	0.060	0.076	5kc6B.pdb.gz
15	PDB:5jovA	0.213	0.061	2.494E-2	949	0.082	0.016	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
16	PDB:6vlsD	0.241	0.057	3.411E-2	963	0.066	0.012	6vlsD.pdb.gz
17	PDB:5a3oA	0.311	0.449	5.455E-2	114	0.066	0.105	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
18	PDB:1t6bX	0.136	0.060	8.280E-2	676	0.082	0.022	1t6bX.pdb.gz	Crystal structure of a complex between anthrax toxin and its host cell receptor
19	PDB:2waaA	0.253	0.163	8.280E-2	335	0.082	0.045	2waaA.pdb.gz
20	PDB:2p0mA	0.176	0.063	8.724E-2	662	0.077	0.021	2p0mA.pdb.gz	Conformational flexibility in mammalian 15S-lipoxygenase: Reinterpretation of the crystallographic data.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23510	4.31e-135	376	183	1.000	1.000	TNFL4_HUMAN Tumor necrosis factor ligand superfamily member 4 OS=Homo sapiens OX=9606 GN=TNFSF4 PE=1 SV=1
2	Q9Z2P3	2.83e-47	155	199	0.464	0.427	TNFL4_RAT Tumor necrosis factor ligand superfamily member 4 OS=Rattus norvegicus OX=10116 GN=Tnfsf4 PE=2 SV=1
3	P43488	3.70e-45	149	198	0.448	0.414	TNFL4_MOUSE Tumor necrosis factor ligand superfamily member 4 OS=Mus musculus OX=10090 GN=Tnfsf4 PE=1 SV=1
4	Q8BWM0	5.2	30.0	384	0.077	0.036	PGES2_MOUSE Prostaglandin E synthase 2 OS=Mus musculus OX=10090 GN=Ptges2 PE=1 SV=3
5	P37242	7.6	29.6	461	0.169	0.067	THB_MOUSE Thyroid hormone receptor beta OS=Mus musculus OX=10090 GN=Thrb PE=1 SV=1
6	A0A0B4K765	7.9	29.6	2066	0.131	0.012	A0A0B4K765_DROME Sin3A, isoform G OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
7	A0A0B4LF82	7.9	29.6	2060	0.131	0.012	A0A0B4LF82_DROME Sin3A, isoform H OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
8	Q54M42	8.4	29.6	2005	0.071	0.006	Q54M42_DICDI SNF2-related domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286219 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18573 BclA_C	76	14.6	BclA C-terminal domain
2	PF10126 Nit_Regul_Hom	2.3e+02	13.2	Uncharacterized protein, homolog of nitrogen regulatory protein PII

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008976561.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008959986.1	0.998	Tumor necrosis factor receptor superfamily member 4
2	9597.XP_008973909.1	0.661	TNF receptor superfamily member 9
3	9597.XP_003819392.1	0.655	Tumor necrosis factor ligand superfamily member 9
4	9597.XP_008971926.1	0.655	CD4 molecule
5	9597.XP_008967848.1	0.651	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 311 ESTs, 9 Proteins, and 71% coverage of the annotated genomic feature by RNAseq alignments
6	9597.XP_003826800.1	0.644	Thymic stromal lymphopoietin isoform X1
7	9597.XP_003816453.1	0.627	Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response.
8	9597.XP_003806315.1	0.599	Podoplanin isoform X1
9	9597.XP_003825194.1	0.592	CD80 molecule
10	9597.XP_008949633.1	0.592	CD40 molecule
11	9597.XP_003819393.1	0.588	Belongs to the tumor necrosis factor family.
12	9597.XP_003812370.1	0.579	Cytokine that acts as a ligand to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Involved in immunoglobulin class switching
13	9597.XP_008971981.1	0.576	CD27 antigen isoform X1
14	9597.XP_003831637.1	0.572	Belongs to the tumor necrosis factor family.
15	9597.XP_003825233.1	0.569	CD86 molecule
16	9597.XP_003823893.1	0.560	Inducible T-cell costimulator ligand
17	9597.XP_003833129.1	0.550	Tumor necrosis factor ligand superfamily member 8 isoform X1
18	9597.XP_003820827.1	0.549	Cytotoxic T-lymphocyte associated protein 4
19	9597.XP_003824716.1	0.540	Tumor necrosis factor ligand superfamily member 18
20	9597.XP_008959956.1	0.537	TNF receptor superfamily member 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050896	0.995	response to stimulus
GO:0050794	0.993	regulation of cellular process
GO:0048583	0.993	regulation of response to stimulus
GO:0023052	0.991	signaling
GO:0042221	0.990	response to chemical
GO:0051716	0.988	cellular response to stimulus
GO:0007154	0.987	cell communication
GO:0001817	0.985	regulation of cytokine production
GO:0010628	0.985	positive regulation of gene expression
GO:1901701	0.984	cellular response to oxygen-containing compound
GO:0010033	0.983	response to organic substance
GO:0051707	0.979	response to other organism
GO:0001819	0.979	positive regulation of cytokine production
GO:0032649	0.978	regulation of type II interferon production
GO:0048522	0.967	positive regulation of cellular process
GO:0048584	0.964	positive regulation of response to stimulus
GO:0071310	0.962	cellular response to organic substance
GO:0007165	0.957	signal transduction
GO:0048519	0.944	negative regulation of biological process
GO:0008284	0.929	positive regulation of cell population proliferation
GO:0033993	0.923	response to lipid
GO:0080134	0.905	regulation of response to stress
GO:0032101	0.893	regulation of response to external stimulus
GO:0002237	0.859	response to molecule of bacterial origin
GO:0071396	0.828	cellular response to lipid
GO:0071216	0.812	cellular response to biotic stimulus
GO:1901654	0.803	response to ketone
GO:0031347	0.773	regulation of defense response
GO:0032496	0.742	response to lipopolysaccharide
GO:1901655	0.730	cellular response to ketone
GO:0009725	0.712	response to hormone
GO:0010605	0.706	negative regulation of macromolecule metabolic process
GO:0071219	0.703	cellular response to molecule of bacterial origin
GO:0050727	0.663	regulation of inflammatory response
GO:0034694	0.661	response to prostaglandin
GO:0071222	0.625	cellular response to lipopolysaccharide
GO:0032103	0.606	positive regulation of response to external stimulus
GO:0051241	0.545	negative regulation of multicellular organismal process
GO:0032675	0.543	regulation of interleukin-6 production
GO:0002682	0.532	regulation of immune system process
GO:0010629	0.521	negative regulation of gene expression
GO:0031349	0.505	positive regulation of defense response
GO:0001818	0.485	negative regulation of cytokine production
GO:0032729	0.466	positive regulation of type II interferon production
GO:0002684	0.414	positive regulation of immune system process
GO:0032501	0.390	multicellular organismal process
GO:0007166	0.381	cell surface receptor signaling pathway
GO:0032755	0.380	positive regulation of interleukin-6 production
GO:0002376	0.369	immune system process
GO:0097305	0.368	response to alcohol
GO:0050865	0.347	regulation of cell activation
GO:0031323	0.341	regulation of cellular metabolic process
GO:0051171	0.336	regulation of nitrogen compound metabolic process
GO:0080090	0.335	regulation of primary metabolic process
GO:0048523	0.329	negative regulation of cellular process
GO:0050729	0.312	positive regulation of inflammatory response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.999	cell surface
GO:0005576	0.997	extracellular region
GO:0005615	0.987	extracellular space
GO:0043227	0.862	membrane-bounded organelle
GO:0005622	0.815	intracellular anatomical structure
GO:0043231	0.692	intracellular membrane-bounded organelle
GO:0012505	0.350	endomembrane system
GO:0005737	0.348	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]