StarFunc result for job id P23511

User Input

>input (347 residues)
MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPL
MVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAV
QVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTIL
QQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMV
PGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLH
ESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23511	1.000	1.000	2.395E-53	347	1.000	1.000	P23511.pdb.gz	NFYA_HUMAN Nuclear transcription factor Y subunit alpha OS=Homo sapiens OX=9606 GN=NFYA PE=1 SV=2
2	AFDB:Q53QW1	0.073	0.069	2.333E-1	395	0.187	0.165	Q53QW1.pdb.gz	TEX44_HUMAN Testis-expressed protein 44 OS=Homo sapiens OX=9606 GN=TEX44 PE=1 SV=1
3	AFDB:O44757	0.098	0.033	4.195E-1	1312	0.153	0.040	O44757.pdb.gz	LIN59_CAEEL Probable histone-lysine N-methyltransferase lin-59 OS=Caenorhabditis elegans OX=6239 GN=lin-59 PE=2 SV=1
4	AFDB:Q8BSM5	0.079	0.052	5.102E-1	595	0.147	0.086	Q8BSM5.pdb.gz	GAB3_MOUSE GRB2-associated-binding protein 3 OS=Mus musculus OX=10090 GN=Gab3 PE=1 SV=1
5	AFDB:Q95SM1	0.078	0.053	5.102E-1	572	0.182	0.110	Q95SM1.pdb.gz	Q95SM1_DROME GH14591p OS=Drosophila melanogaster OX=7227 GN=dikar PE=2 SV=1
6	AFDB:A0A2R8QQL1	0.062	0.031	7.544E-1	1108	0.182	0.057	A0A2R8QQL1.pdb.gz
7	AFDB:E9PMC9	0.063	0.023	8.595E-1	1224	0.210	0.060	E9PMC9.pdb.gz	E9PMC9_HUMAN EMSY transcriptional repressor, BRCA2 interacting OS=Homo sapiens OX=9606 GN=EMSY PE=1 SV=1
8	AFDB:Q17865	0.073	0.048	9.174E-1	545	0.170	0.108	Q17865.pdb.gz	YTE4_CAEEL Uncharacterized protein C09G1.4 OS=Caenorhabditis elegans OX=6239 GN=C09G1.4 PE=1 SV=3
9	AFDB:E1JIP0	0.075	0.042	1.045	717	0.147	0.071	E1JIP0.pdb.gz	E1JIP0_DROME FI18283p1 OS=Drosophila melanogaster OX=7227 GN=sr PE=2 SV=1
10	AFDB:Q9FH18	0.072	0.054	1.116	509	0.133	0.090	Q9FH18.pdb.gz	WIP2_ARATH WPP domain-interacting protein 2 OS=Arabidopsis thaliana OX=3702 GN=WIP2 PE=1 SV=1
11	PDB:4pa0A	0.046	0.019	3.828	974	0.020	0.007	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
12	PDB:4uhvB	0.064	0.044	4.086	645	0.040	0.022	4uhvB.pdb.gz
13	PDB:6gjvC	0.051	0.042	4.086	429	0.012	0.009	6gjvC.pdb.gz
14	PDB:4pa0B	0.042	0.018	5.304	920	0.020	0.008	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
15	PDB:6sgbCK	0.065	0.094	5.304	211	0.032	0.052	6sgbCK.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
16	PDB:7yxgA	0.057	0.063	5.304	313	0.009	0.010	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
17	PDB:2a87A	0.037	0.041	5.661	313	0.014	0.016	2a87A.pdb.gz	Conformational flexibility of Mycobacterium tuberculosis thioredoxin reductase: crystal structure and normal-mode analysis.
18	PDB:6p3eA	0.039	0.049	5.661	246	0.029	0.041	6p3eA.pdb.gz
19	PDB:6gk9G	0.051	0.054	6.043	329	0.012	0.012	6gk9G.pdb.gz	First-in-class allosteric inhibitors of bacterial IMPDHs.
20	PDB:1nr4E	0.046	0.195	6.450	69	0.017	0.087	1nr4E.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18576	0.0	647	341	0.983	1.000	NFYA_RAT Nuclear transcription factor Y subunit alpha OS=Rattus norvegicus OX=10116 GN=Nfya PE=1 SV=1
2	P23511	0.0	665	347	1.000	1.000	NFYA_HUMAN Nuclear transcription factor Y subunit alpha OS=Homo sapiens OX=9606 GN=NFYA PE=1 SV=2
3	P23708	0.0	656	346	0.994	0.997	NFYA_MOUSE Nuclear transcription factor Y subunit alpha OS=Mus musculus OX=10090 GN=Nfya PE=1 SV=2
4	Q9VSY9	1.16e-26	111	399	0.147	0.128	Q9VSY9_DROME Nuclear transcription factor Y subunit OS=Drosophila melanogaster OX=7227 GN=Nf-YA PE=2 SV=1
5	Q9LNP6	2.24e-24	103	328	0.127	0.134	NFYA8_ARATH Nuclear transcription factor Y subunit A-8 OS=Arabidopsis thaliana OX=3702 GN=NFYA8 PE=1 SV=2
6	P06774	5.25e-24	101	265	0.147	0.192	HAP2_YEAST Transcriptional activator HAP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HAP2 PE=1 SV=1
7	Q9SYH4	1.35e-23	100	308	0.127	0.143	NFYA5_ARATH Nuclear transcription factor Y subunit A-5 OS=Arabidopsis thaliana OX=3702 GN=NFYA5 PE=2 SV=1
8	Q84JP1	4.09e-23	97.1	190	0.130	0.237	NFYA7_ARATH Nuclear transcription factor Y subunit A-7 OS=Arabidopsis thaliana OX=3702 GN=NFYA7 PE=1 SV=1
9	Q9LVJ7	2.89e-22	97.4	308	0.150	0.169	NFYA6_ARATH Nuclear transcription factor Y subunit A-6 OS=Arabidopsis thaliana OX=3702 GN=NFYA6 PE=1 SV=1
10	A0A1D8PE35	3.10e-22	98.2	364	0.124	0.118	A0A1D8PE35_CANAL Transcriptional activator HAP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HAP2 PE=3 SV=1
11	Q945M9	5.13e-20	90.9	303	0.130	0.149	NFYA9_ARATH Nuclear transcription factor Y subunit A-9 OS=Arabidopsis thaliana OX=3702 GN=NFYA9 PE=1 SV=1
12	Q8VY64	8.26e-20	88.2	198	0.115	0.202	NFYA4_ARATH Nuclear transcription factor Y subunit A-4 OS=Arabidopsis thaliana OX=3702 GN=NFYA4 PE=1 SV=1
13	P24488	9.38e-19	87.8	334	0.112	0.117	HAP2_SCHPO Transcriptional activator hap2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hap2 PE=3 SV=1
14	Q9LXV5	3.95e-18	85.1	272	0.107	0.136	NFYA1_ARATH Nuclear transcription factor Y subunit A-1 OS=Arabidopsis thaliana OX=3702 GN=NFYA1 PE=2 SV=1
15	G5EEG1	3.51e-17	84.7	482	0.127	0.091	NFYA1_CAEEL Nuclear transcription factor Y subunit nfya-1 OS=Caenorhabditis elegans OX=6239 GN=nfya-1 PE=1 SV=1
16	Q9M9X4	1.19e-14	75.5	295	0.101	0.119	NFYA2_ARATH Nuclear transcription factor Y subunit A-2 OS=Arabidopsis thaliana OX=3702 GN=NFYA2 PE=1 SV=1
17	Q5ZEP9	2.69e-14	74.3	281	0.092	0.114	NFYA2_CAEEL Nuclear transcription factor Y subunit nfya-2 OS=Caenorhabditis elegans OX=6239 GN=nfya-2 PE=1 SV=2
18	P78820	0.020	39.7	2280	0.127	0.019	ACAC_SCHPO Acetyl-CoA carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut6 PE=1 SV=2
19	Q13085	2.7	32.7	2346	0.124	0.018	ACACA_HUMAN Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02045 CBFB_NFYA	7e-24	95.5	CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008836148.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008833655.1	0.999	Nuclear transcription factor Y subunit gamma isoform X1
2	1026970.XP_008841369.1	0.999	Nuclear transcription factor Y subunit beta isoform X1
3	1026970.XP_008849289.1	0.973	Chromatin accessibility complex protein 1 isoform X1
4	1026970.XP_008830953.1	0.898	DNA polymerase epsilon subunit 4
5	1026970.XP_008854009.1	0.896	Tumor protein p53
6	1026970.XP_008841626.1	0.875	TATA-box-binding protein
7	1026970.XP_008837755.1	0.868	TATA box-binding protein-like protein 2
8	1026970.XP_008828152.1	0.861	MHC class II transactivator isoform X1
9	1026970.XP_008820320.1	0.845	TATA-box binding protein like 1
10	1026970.XP_008836225.1	0.750	Zinc fingers and homeoboxes protein 1
11	1026970.XP_008836813.1	0.744	Sp1 transcription factor
12	1026970.XP_008843692.1	0.693	V-myc avian myelocytomatosis viral oncogene homolog
13	1026970.XP_008836210.1	0.662	Zinc fingers and homeoboxes protein 2
14	1026970.XP_008853744.1	0.647	BRCA1, DNA repair associated
15	1026970.XP_008850354.1	0.642	MYC associated factor X
16	1026970.XP_008822708.1	0.641	Regulatory factor X associated ankyrin containing protein
17	1026970.XP_008836162.1	0.641	Unc-5 family C-terminal like
18	1026970.XP_008847810.1	0.633	Zinc fingers and homeoboxes 3
19	1026970.XP_008822631.1	0.628	RB transcriptional corepressor 1
20	1026970.XP_008824872.1	0.614	Uncharacterized protein LOC103728687

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.817	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008134	0.743	transcription factor binding
GO:0001216	0.732	DNA-binding transcription activator activity
GO:0001228	0.302	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0009987	0.984	cellular process
GO:0048522	0.978	positive regulation of cellular process
GO:0009893	0.976	positive regulation of metabolic process
GO:0010556	0.975	regulation of macromolecule biosynthetic process
GO:0031326	0.975	regulation of cellular biosynthetic process
GO:0051252	0.975	regulation of RNA metabolic process
GO:0006357	0.974	regulation of transcription by RNA polymerase II
GO:0045893	0.972	positive regulation of DNA-templated transcription
GO:0044237	0.961	cellular metabolic process
GO:0006807	0.949	nitrogen compound metabolic process
GO:0043170	0.948	macromolecule metabolic process
GO:1901360	0.940	organic cyclic compound metabolic process
GO:0045944	0.930	positive regulation of transcription by RNA polymerase II
GO:1901576	0.915	organic substance biosynthetic process
GO:0006725	0.822	cellular aromatic compound metabolic process
GO:0006139	0.801	nucleobase-containing compound metabolic process
GO:1901362	0.791	organic cyclic compound biosynthetic process
GO:0090304	0.735	nucleic acid metabolic process
GO:0044249	0.707	cellular biosynthetic process
GO:0016070	0.678	RNA metabolic process
GO:0010467	0.659	gene expression
GO:0032774	0.586	RNA biosynthetic process
GO:0006351	0.534	DNA-templated transcription
GO:0006366	0.491	transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.989	protein-containing complex
GO:0140513	0.946	nuclear protein-containing complex
GO:0005667	0.937	transcription regulator complex
GO:0090575	0.884	RNA polymerase II transcription regulator complex
GO:0005737	0.512	cytoplasm
GO:0016602	0.435	CCAAT-binding factor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]