StarFunc result for job id P23515

User Input

>input (440 residues)
MEYQILKMSLCLFILLFLTPGILCICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHL
NLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTA
YQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLT
QILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLK
WMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKV
TKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDG
MVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVAN
AWKVNASFLLLLNVVVMLAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23515	1.000	1.000	3.663E-64	440	1.000	1.000	P23515.pdb.gz	OMGP_HUMAN Oligodendrocyte-myelin glycoprotein OS=Homo sapiens OX=9606 GN=OMG PE=1 SV=2
2	AFDB:Q63912	0.598	0.598	1.259E-55	440	0.861	0.861	Q63912.pdb.gz	OMGP_MOUSE Oligodendrocyte-myelin glycoprotein OS=Mus musculus OX=10090 GN=Omg PE=1 SV=1
3	PDB:2ft3F	0.408	0.577	3.723E-9	305	0.127	0.184	2ft3F.pdb.gz
4	PDB:5yq5B	0.408	0.571	3.723E-9	306	0.143	0.206	5yq5B.pdb.gz
5	PDB:6hkwA	0.320	0.426	6.215E-8	306	0.123	0.176	6hkwA.pdb.gz
6	PDB:1xcdA	0.362	0.498	6.872E-8	305	0.132	0.190	1xcdA.pdb.gz
7	PDB:7tvfD	0.405	0.348	1.321E-7	515	0.132	0.113	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
8	AFDB:Q6UXM1	0.318	0.143	7.822E-7	1119	0.123	0.048	Q6UXM1.pdb.gz	LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens OX=9606 GN=LRIG3 PE=1 SV=1
9	PDB:6gffI	0.237	0.201	1.631E-6	551	0.145	0.116	6gffI.pdb.gz
10	PDB:3b2dA	0.407	0.306	7.008E-6	601	0.098	0.072	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
11	PDB:7lt9A	0.359	0.602	7.749E-6	251	0.127	0.223	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
12	PDB:5y31B	0.177	0.161	1.566E-5	511	0.095	0.082	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
13	PDB:7wv3A	0.341	0.236	1.821E-5	668	0.134	0.088	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
14	AFDB:D4A1J9	0.456	0.292	4.363E-5	719	0.220	0.135	D4A1J9.pdb.gz	LRFN5_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Lrfn5 PE=1 SV=1
15	AFDB:Q96PE1	0.265	0.101	1.291E-1	1338	0.118	0.039	Q96PE1.pdb.gz	AGRA2_HUMAN Adhesion G protein-coupled receptor A2 OS=Homo sapiens OX=9606 GN=ADGRA2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23515	0.0	896	440	1.000	1.000	OMGP_HUMAN Oligodendrocyte-myelin glycoprotein OS=Homo sapiens OX=9606 GN=OMG PE=1 SV=2
2	Q63912	0.0	797	440	0.886	0.886	OMGP_MOUSE Oligodendrocyte-myelin glycoprotein OS=Mus musculus OX=10090 GN=Omg PE=1 SV=1
3	Q7Z5L7	9.59e-16	81.6	613	0.164	0.117	PODN_HUMAN Podocan OS=Homo sapiens OX=9606 GN=PODN PE=1 SV=2
4	Q6P3Y9	2.14e-14	77.4	559	0.152	0.120	PONL1_MOUSE Podocan-like protein 1 OS=Mus musculus OX=10090 GN=Podnl1 PE=1 SV=3
5	Q8BLU0	2.14e-14	77.8	660	0.145	0.097	FLRT2_MOUSE Leucine-rich repeat transmembrane protein FLRT2 OS=Mus musculus OX=10090 GN=Flrt2 PE=1 SV=1
6	Q3V1M1	1.09e-13	75.9	2594	0.168	0.029	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
7	Q803T1	6.76e-13	72.0	373	0.141	0.166	Q803T1_DANRE Decorin OS=Danio rerio OX=7955 GN=decorin PE=1 SV=1
8	Q9NZU1	9.57e-13	72.4	646	0.134	0.091	FLRT1_HUMAN Leucine-rich repeat transmembrane protein FLRT1 OS=Homo sapiens OX=9606 GN=FLRT1 PE=1 SV=3
9	O88279	1.02e-12	72.8	1531	0.145	0.042	SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1
10	O43155	1.03e-12	72.4	660	0.141	0.094	FLRT2_HUMAN Leucine-rich repeat transmembrane protein FLRT2 OS=Homo sapiens OX=9606 GN=FLRT2 PE=1 SV=1
11	F1RCV3	1.29e-12	72.4	1516	0.134	0.039	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
12	Q80TR4	1.94e-12	72.0	1531	0.145	0.042	SLIT1_MOUSE Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2
13	Q6RKD8	2.62e-12	71.2	646	0.134	0.091	FLRT1_MOUSE Leucine-rich repeat transmembrane protein FLRT1 OS=Mus musculus OX=10090 GN=Flrt1 PE=1 SV=2
14	O75093	3.26e-12	71.2	1534	0.141	0.040	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
15	Q13641	3.43e-12	70.1	420	0.166	0.174	TPBG_HUMAN Trophoblast glycoprotein OS=Homo sapiens OX=9606 GN=TPBG PE=1 SV=1
16	Q5RKR3	3.88e-12	70.9	745	0.134	0.079	ISLR2_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Mus musculus OX=10090 GN=Islr2 PE=1 SV=1
17	Q9CQ76	4.01e-12	70.1	512	0.120	0.104	NEPN_MOUSE Nephrocan OS=Mus musculus OX=10090 GN=Nepn PE=1 SV=1
18	Q86VH5	5.49e-12	70.1	581	0.186	0.141	LRRT3_HUMAN Leucine-rich repeat transmembrane neuronal protein 3 OS=Homo sapiens OX=9606 GN=LRRTM3 PE=2 SV=2
19	Q8BZ81	5.49e-12	70.1	582	0.195	0.148	LRRT3_MOUSE Leucine-rich repeat transmembrane neuronal protein 3 OS=Mus musculus OX=10090 GN=Lrrtm3 PE=2 SV=2
20	Q6UXK2	6.89e-12	70.1	745	0.127	0.075	ISLR2_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Homo sapiens OX=9606 GN=ISLR2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02469 Fasciclin	93	14.7	Fasciclin domain
2	PF01462 LRRNT	2.9e-05	34.8	Leucine rich repeat N-terminal domain
3	PF00560 LRR_1	3.1e-06	37.7	Leucine Rich Repeat
4	PF12799 LRR_4	4.5e-12	57.2	Leucine Rich repeats (2 copies)
5	PF13306 LRR_5	1.7e+02	13.6	BspA type Leucine rich repeat region (6 copies)
6	PF13855 LRR_8	8.7e-14	62.4	Leucine rich repeat
7	PF06031 SERTA	1.5e+02	13.5	SERTA motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000247271

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337838	0.986	Reticulon-4
2	9606.ENSP00000376048	0.977	Myelin-associated glycoprotein
3	9606.ENSP00000043402	0.959	Reticulon-4 receptor
4	9606.ENSP00000172229	0.959	Tumor necrosis factor receptor superfamily member 16
5	9606.ENSP00000347451	0.940	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
6	9606.ENSP00000400175	0.851	Transforming protein RhoA
7	9606.ENSP00000333779	0.769	Protein EVI2B
8	9606.ENSP00000247270	0.766	Protein EVI2A
9	9606.ENSP00000371693	0.763	Tumor necrosis factor receptor superfamily member 19
10	9606.ENSP00000481006	0.735	Myelin proteolipid protein
11	9606.ENSP00000245620	0.734	Leukocyte immunoglobulin-like receptor subfamily B member 3
12	9606.ENSP00000269321	0.733	Rho GDP-dissociation inhibitor 1
13	9606.ENSP00000468500	0.720	Glial fibrillary acidic protein
14	9606.ENSP00000315997	0.658	Leukocyte immunoglobulin-like receptor subfamily B member 1
15	9606.ENSP00000470560	0.641	Ribosomal RNA small subunit methyltransferase NEP1
16	9606.ENSP00000377372	0.633	Neuromodulin
17	9606.ENSP00000355370	0.627	Ciliary neurotrophic factor
18	9606.ENSP00000226091	0.626	Ephrin-B3
19	9606.ENSP00000380958	0.607	Myelin basic protein
20	9606.ENSP00000416523	0.603	Semaphorin-4D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0032501	0.994	multicellular organismal process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0048731	0.977	system development
GO:0050896	0.970	response to stimulus
GO:0016043	0.958	cellular component organization
GO:0007399	0.902	nervous system development
GO:0031344	0.846	regulation of cell projection organization
GO:0051716	0.831	cellular response to stimulus
GO:0120035	0.805	regulation of plasma membrane bounded cell projection organization
GO:0010975	0.804	regulation of neuron projection development
GO:0090066	0.803	regulation of anatomical structure size
GO:0008361	0.748	regulation of cell size
GO:0022008	0.717	neurogenesis
GO:0030182	0.714	neuron differentiation
GO:0050793	0.693	regulation of developmental process
GO:0048666	0.689	neuron development
GO:0040008	0.679	regulation of growth
GO:0048583	0.678	regulation of response to stimulus
GO:0022603	0.603	regulation of anatomical structure morphogenesis
GO:0001558	0.578	regulation of cell growth
GO:0061387	0.572	regulation of extent of cell growth
GO:0048638	0.516	regulation of developmental growth
GO:0050770	0.480	regulation of axonogenesis
GO:0080134	0.468	regulation of response to stress
GO:0030030	0.467	cell projection organization
GO:0048518	0.446	positive regulation of biological process
GO:0120036	0.397	plasma membrane bounded cell projection organization
GO:0048519	0.365	negative regulation of biological process
GO:0048523	0.322	negative regulation of cellular process
GO:0048522	0.317	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.645	extracellular region
GO:0043227	0.314	membrane-bounded organelle
GO:0005622	0.311	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]