StarFunc result for job id P23526

User Input

>input (432 residues)
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVET
AVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYF
KDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV
NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN
SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS
CDGPFKPDHYRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384MTQ3	0.999	0.999	1.614E-86	432	1.000	1.000	A0A384MTQ3.pdb.gz	A0A384MTQ3_HUMAN Adenosylhomocysteinase OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q803T5	0.996	0.994	6.555E-80	433	0.863	0.861	Q803T5.pdb.gz	Q803T5_DANRE Adenosylhomocysteinase OS=Danio rerio OX=7955 GN=AHCY PE=1 SV=1
3	PDB:1a7aA	0.996	0.998	2.605E-79	431	0.995	0.998	1a7aA.pdb.gz	Structure determination of selenomethionyl S-adenosylhomocysteine hydrolase using data at a single wavelength.
4	AFDB:Q27580	0.991	0.991	1.341E-74	432	0.806	0.806	Q27580.pdb.gz	SAHH_DROME Adenosylhomocysteinase OS=Drosophila melanogaster OX=7227 GN=Ahcy PE=1 SV=2
5	AFDB:O13639	0.990	0.988	1.098E-73	433	0.769	0.767	O13639.pdb.gz	SAHH_SCHPO Adenosylhomocysteinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi047 PE=3 SV=1
6	AFDB:P10819	0.991	0.993	5.902E-72	431	0.752	0.754	P10819.pdb.gz	SAHH_DICDI Adenosylhomocysteinase OS=Dictyostelium discoideum OX=44689 GN=sahA PE=1 SV=2
7	AFDB:P39954	0.985	0.948	4.366E-68	449	0.727	0.699	P39954.pdb.gz	SAHH_YEAST Adenosylhomocysteinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAH1 PE=1 SV=1
8	AFDB:P83783	0.983	0.944	5.757E-68	450	0.734	0.704	P83783.pdb.gz	SAHH_CANAL Adenosylhomocysteinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAH1 PE=1 SV=2
9	AFDB:Q383X0	0.980	0.968	8.024E-68	437	0.729	0.721	Q383X0.pdb.gz	Q383X0_TRYB2 Adenosylhomocysteinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1350 PE=1 SV=1
10	PDB:3h9uC	0.980	0.973	1.344E-66	435	0.729	0.724	3h9uC.pdb.gz	Crystal structure of S-adenosyl homocysteine hydrolase (SAHH) from Trypanosoma brucei
11	AFDB:P9WGV3	0.971	0.849	7.071E-61	495	0.613	0.535	P9WGV3.pdb.gz	SAHH_MYCTU Adenosylhomocysteinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ahcY PE=1 SV=1
12	AFDB:O23255	0.967	0.862	2.579E-59	485	0.611	0.544	O23255.pdb.gz	SAHH1_ARATH Adenosylhomocysteinase 1 OS=Arabidopsis thaliana OX=3702 GN=SAHH1 PE=1 SV=1
13	PDB:3ce6A	0.972	0.865	1.145E-58	486	0.616	0.547	3ce6A.pdb.gz	Crystal structures of Mycobacterium tuberculosis S-adenosyl-L-homocysteine hydrolase in ternary complex with substrate and inhibitors.
14	PDB:2vhwE	0.407	0.458	2.872E-10	373	0.125	0.145	2vhwE.pdb.gz	Three-Dimensional Structures of Apo- and Holo-L-Alanine Dehydrogenase from Mycobacterium Tuberculosis Reveal Conformational Changes Upon Coenzyme Binding.
15	PDB:1u2gB	0.391	0.451	2.935E-9	359	0.111	0.134	1u2gB.pdb.gz	Active-site conformational changes associated with hydride transfer in proton-translocating transhydrogenase.
16	PDB:2gcgA	0.389	0.487	6.730E-9	324	0.116	0.154	2gcgA.pdb.gz	Structural basis of substrate specificity in human glyoxylate reductase/hydroxypyruvate reductase
17	PDB:1ygyA	0.343	0.292	1.926E-8	527	0.134	0.110	1ygyA.pdb.gz
18	PDB:4j1tE	0.398	0.445	4.417E-8	373	0.116	0.134	4j1tE.pdb.gz	Crystal structure analysis of Thermus thermophilus transhydrogenase soluble domains
19	PDB:1f8gA	0.387	0.427	6.506E-8	382	0.137	0.154	1f8gA.pdb.gz	Protein-protein recognition, hydride transfer and proton pumping in the transhydrogenase complex.
20	PDB:2fssA	0.408	0.482	7.681E-8	353	0.118	0.144	2fssA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384MTQ3	0.0	900	432	1.000	1.000	A0A384MTQ3_HUMAN Adenosylhomocysteinase OS=Homo sapiens OX=9606 PE=2 SV=1
2	O13639	0.0	680	433	0.766	0.764	SAHH_SCHPO Adenosylhomocysteinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi047 PE=3 SV=1
3	P10760	0.0	869	432	0.965	0.965	SAHH_RAT Adenosylhomocysteinase OS=Rattus norvegicus OX=10116 GN=Ahcy PE=1 SV=3
4	P10819	0.0	669	431	0.752	0.754	SAHH_DICDI Adenosylhomocysteinase OS=Dictyostelium discoideum OX=44689 GN=sahA PE=1 SV=2
5	P23526	0.0	900	432	1.000	1.000	SAHH_HUMAN Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY PE=1 SV=4
6	P39954	0.0	636	449	0.727	0.699	SAHH_YEAST Adenosylhomocysteinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAH1 PE=1 SV=1
7	P50247	0.0	872	432	0.970	0.970	SAHH_MOUSE Adenosylhomocysteinase OS=Mus musculus OX=10090 GN=Ahcy PE=1 SV=3
8	P83783	0.0	636	450	0.734	0.704	SAHH_CANAL Adenosylhomocysteinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAH1 PE=1 SV=2
9	P9WGV3	0.0	516	495	0.618	0.539	SAHH_MYCTU Adenosylhomocysteinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ahcY PE=1 SV=1
10	Q27580	0.0	711	432	0.806	0.806	SAHH_DROME Adenosylhomocysteinase OS=Drosophila melanogaster OX=7227 GN=Ahcy PE=1 SV=2
11	Q383X0	0.0	645	437	0.727	0.719	Q383X0_TRYB2 Adenosylhomocysteinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1350 PE=1 SV=1
12	Q6FWX3	0.0	646	449	0.729	0.702	Q6FWX3_CANGA Adenosylhomocysteinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SAH1 PE=3 SV=1
13	Q803T5	0.0	791	433	0.863	0.861	Q803T5_DANRE Adenosylhomocysteinase OS=Danio rerio OX=7955 GN=AHCY PE=1 SV=1
14	O23255	5.21e-172	492	485	0.616	0.548	SAHH1_ARATH Adenosylhomocysteinase 1 OS=Arabidopsis thaliana OX=3702 GN=SAHH1 PE=1 SV=1
15	Q9LK36	5.25e-169	484	485	0.609	0.542	SAHH2_ARATH Adenosylhomocysteinase 2 OS=Arabidopsis thaliana OX=3702 GN=SAHH2 PE=2 SV=1
16	Q7T2B5	2.48e-158	459	512	0.495	0.418	Q7T2B5_DANRE Adenosylhomocysteinase OS=Danio rerio OX=7955 GN=wu:fj66f02 PE=1 SV=1
17	A5PMG3	3.73e-158	457	500	0.495	0.428	A5PMG3_DANRE Adenosylhomocysteinase OS=Danio rerio OX=7955 GN=cb586 PE=1 SV=1
18	Q9VZX9	2.21e-156	454	521	0.509	0.422	SAHH2_DROME Adenosylhomocysteinase-like 1 OS=Drosophila melanogaster OX=7227 GN=AhcyL1 PE=1 SV=1
19	A6QLP2	1.43e-155	455	611	0.500	0.354	SAHH3_BOVIN Adenosylhomocysteinase 3 OS=Bos taurus OX=9913 GN=AHCYL2 PE=1 SV=1
20	Q68FL4	1.87e-155	455	613	0.498	0.351	SAHH3_MOUSE Putative adenosylhomocysteinase 3 OS=Mus musculus OX=10090 GN=Ahcyl2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	7.8e-05	33.6	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF02737 3HCDH_N	1.1e+02	14.1	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
3	PF05221 AdoHcyase	1.3e-130	446.5	S-adenosyl-L-homocysteine hydrolase
4	PF00670 AdoHcyase_NAD	2.8e-83	289.4	S-adenosyl-L-homocysteine hydrolase, NAD binding domain
5	PF07991 IlvN	0.089	23.9	Acetohydroxy acid isomeroreductase, NADPH-binding domain
6	PF02254 TrkA_N	6	18.5	TrkA-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217426

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355536	0.983	Methionine synthase
2	9606.ENSP00000274353	0.980	Betaine--homocysteine S-methyltransferase 1
3	9606.ENSP00000381231	0.978	Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L- homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
4	9606.ENSP00000286621	0.965	Adenosine kinase
5	9606.ENSP00000255192	0.963	S-methylmethionine--homocysteine S-methyltransferase BHMT2
6	9606.ENSP00000352516	0.961	DNA (cytosine-5)-methyltransferase 1
7	9606.ENSP00000359976	0.960	Cystathionine gamma-lyase
8	9606.ENSP00000328547	0.946	DNA (cytosine-5)-methyltransferase 3B
9	9606.ENSP00000361287	0.941	S-adenosylmethionine synthase isoform type-1
10	9606.ENSP00000303147	0.938	S-adenosylmethionine synthase isoform type-2
11	9606.ENSP00000264709	0.936	DNA (cytosine-5)-methyltransferase 3A
12	9606.ENSP00000260508	0.917	Kynurenine--oxoglutarate transaminase 3
13	9606.ENSP00000399415	0.915	Kynurenine--oxoglutarate transaminase 1
14	9606.ENSP00000361603	0.899	Uncharacterized protein C1orf50
15	9606.ENSP00000358814	0.877	S-adenosylhomocysteine hydrolase-like protein 1
16	9606.ENSP00000365777	0.846	Methylenetetrahydrofolate reductase
17	9606.ENSP00000296412	0.843	Alcohol dehydrogenase class-3
18	9606.ENSP00000379386	0.841	Lactate dehydrogenase B
19	9606.ENSP00000315931	0.834	Adenosylhomocysteinase 3
20	9606.ENSP00000333667	0.829	Serine hydroxymethyltransferase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004013	0.998	adenosylhomocysteinase activity
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.996	organic cyclic compound binding
GO:0030554	0.945	adenyl nucleotide binding
GO:0043167	0.826	ion binding
GO:0043168	0.728	anion binding
GO:0003676	0.654	nucleic acid binding
GO:0003723	0.302	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0034641	0.996	cellular nitrogen compound metabolic process
GO:0006575	0.992	cellular modified amino acid metabolic process
GO:0009164	0.992	nucleoside catabolic process
GO:0042454	0.977	ribonucleoside catabolic process
GO:0042219	0.975	cellular modified amino acid catabolic process
GO:1901606	0.970	alpha-amino acid catabolic process
GO:0044273	0.962	sulfur compound catabolic process
GO:0072521	0.955	purine-containing compound metabolic process
GO:0009063	0.955	amino acid catabolic process
GO:0042278	0.953	purine nucleoside metabolic process
GO:0046128	0.940	purine ribonucleoside metabolic process
GO:0072523	0.624	purine-containing compound catabolic process
GO:0065007	0.304	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005576	0.873	extracellular region
GO:0043229	0.852	intracellular organelle
GO:0043227	0.850	membrane-bounded organelle
GO:0005615	0.842	extracellular space
GO:0043231	0.708	intracellular membrane-bounded organelle
GO:0070013	0.528	intracellular organelle lumen
GO:0005634	0.322	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21708	0.998	H2O + S-adenosyl-L-homocysteine = adenosine + L-homocysteine
EC:3.13.2.1	0.998	adenosylhomocysteinase.

[back to server]