StarFunc result for job id P23528

User Input

>input (166 residues)
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10668	0.997	0.997	1.856E-35	166	0.994	0.994	P10668.pdb.gz	COF1_PIG Cofilin-1 OS=Sus scrofa OX=9823 GN=CFL1 PE=1 SV=3
2	AFDB:P21566	0.994	0.994	1.691E-32	166	0.819	0.819	P21566.pdb.gz	COF2_CHICK Cofilin-2 OS=Gallus gallus OX=9031 GN=CFL2 PE=1 SV=2
3	AFDB:P45593	0.992	0.980	1.445E-31	168	0.753	0.744	P45593.pdb.gz	COF1B_XENLA Cofilin-1-B OS=Xenopus laevis OX=8355 GN=cfl1-b PE=1 SV=3
4	AFDB:P60981	0.982	0.988	1.863E-29	165	0.711	0.715	P60981.pdb.gz	DEST_HUMAN Destrin OS=Homo sapiens OX=9606 GN=DSTN PE=1 SV=3
5	AFDB:Q6TH32	0.959	0.965	3.729E-29	165	0.747	0.752	Q6TH32.pdb.gz	Q6TH32_DANRE Cofilin-1 OS=Danio rerio OX=7955 GN=CFL2 PE=1 SV=1
6	PDB:1tvjA	0.922	0.922	2.484E-27	166	0.819	0.819	1tvjA.pdb.gz
7	PDB:1q8gA	0.895	0.895	1.168E-23	166	1.000	1.000	1q8gA.pdb.gz
8	AFDB:Q03048	0.744	0.859	1.940E-14	143	0.337	0.392	Q03048.pdb.gz	COFI_YEAST Cofilin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COF1 PE=1 SV=1
9	AFDB:Q6FV81	0.734	0.846	2.201E-14	143	0.343	0.399	Q6FV81.pdb.gz	COFI_CANGA Cofilin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=COF1 PE=3 SV=1
10	AFDB:P78929	0.756	0.910	4.694E-14	137	0.319	0.387	P78929.pdb.gz	COFI_SCHPO Cofilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cof1 PE=1 SV=1
11	AFDB:P0DJ26	0.771	0.928	1.288E-13	137	0.265	0.321	P0DJ26.pdb.gz	COFA_DICDI Cofilin-1A OS=Dictyostelium discoideum OX=44689 GN=cofA PE=1 SV=1
12	AFDB:Q4JHK7	0.740	0.877	1.766E-13	139	0.295	0.353	Q4JHK7.pdb.gz	Q4JHK7_GOSHI Actin depolymerizing factor OS=Gossypium hirsutum OX=3635 GN=ADF1 PE=2 SV=2
13	PDB:1cofA	0.736	0.896	2.074E-13	135	0.325	0.400	1cofA.pdb.gz
14	PDB:2i2qA	0.682	0.918	1.377E-12	122	0.289	0.393	2i2qA.pdb.gz
15	PDB:2mv2A	0.677	0.750	1.772E-12	148	0.283	0.318	2mv2A.pdb.gz
16	PDB:1v6fA	0.717	0.782	2.013E-10	151	0.181	0.199	1v6fA.pdb.gz
17	PDB:1wfsA	0.709	0.773	2.359E-9	151	0.163	0.179	1wfsA.pdb.gz
18	PDB:7cccB	0.699	0.357	4.035E-8	342	0.133	0.064	7cccB.pdb.gz	The structure of the actin filament uncapping complex mediated by twinfilin.
19	PDB:2xf1A	0.535	0.713	1.518E-7	122	0.217	0.295	2xf1A.pdb.gz
20	PDB:2lj8A	0.577	0.681	1.954E-7	136	0.229	0.279	2lj8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23528	3.46e-119	335	166	1.000	1.000	COF1_HUMAN Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3
2	P45592	1.50e-118	333	166	0.994	0.994	COF1_RAT Cofilin-1 OS=Rattus norvegicus OX=10116 GN=Cfl1 PE=1 SV=3
3	P10668	3.43e-118	332	166	0.994	0.994	COF1_PIG Cofilin-1 OS=Sus scrofa OX=9823 GN=CFL1 PE=1 SV=3
4	P18760	4.81e-118	332	166	0.988	0.988	COF1_MOUSE Cofilin-1 OS=Mus musculus OX=10090 GN=Cfl1 PE=1 SV=3
5	P21566	6.36e-98	281	166	0.819	0.819	COF2_CHICK Cofilin-2 OS=Gallus gallus OX=9031 GN=CFL2 PE=1 SV=2
6	P45591	3.93e-97	279	166	0.813	0.813	COF2_MOUSE Cofilin-2 OS=Mus musculus OX=10090 GN=Cfl2 PE=1 SV=1
7	Q549N0	1.16e-96	278	166	0.807	0.807	Q549N0_HUMAN Cofilin 2 (Muscle), isoform CRA_a OS=Homo sapiens OX=9606 GN=CFL2 PE=1 SV=1
8	Q9Y281	1.16e-96	278	166	0.807	0.807	COF2_HUMAN Cofilin-2 OS=Homo sapiens OX=9606 GN=CFL2 PE=1 SV=1
9	P45593	1.26e-89	260	168	0.753	0.744	COF1B_XENLA Cofilin-1-B OS=Xenopus laevis OX=8355 GN=cfl1-b PE=1 SV=3
10	P45695	5.41e-88	256	168	0.753	0.744	COF1A_XENLA Cofilin-1-A OS=Xenopus laevis OX=8355 GN=cfl1-a PE=1 SV=3
11	Q6TH32	2.44e-84	247	165	0.753	0.758	Q6TH32_DANRE Cofilin-1 OS=Danio rerio OX=7955 GN=CFL2 PE=1 SV=1
12	Q9R0P5	1.62e-82	242	165	0.705	0.709	DEST_MOUSE Destrin OS=Mus musculus OX=10090 GN=Dstn PE=1 SV=3
13	P60981	5.67e-82	241	165	0.711	0.715	DEST_HUMAN Destrin OS=Homo sapiens OX=9606 GN=DSTN PE=1 SV=3
14	Q03048	3.38e-28	103	143	0.325	0.378	COFI_YEAST Cofilin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COF1 PE=1 SV=1
15	Q6FV81	5.17e-27	100	143	0.349	0.406	COFI_CANGA Cofilin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=COF1 PE=3 SV=1
16	P78929	3.62e-25	95.9	137	0.301	0.365	COFI_SCHPO Cofilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cof1 PE=1 SV=1
17	P0DJ26	2.08e-21	86.3	137	0.277	0.336	COFA_DICDI Cofilin-1A OS=Dictyostelium discoideum OX=44689 GN=cofA PE=1 SV=1
18	P0DJ27	2.08e-21	86.3	137	0.277	0.336	COFB_DICDI Cofilin-1B OS=Dictyostelium discoideum OX=44689 GN=cofB PE=1 SV=1
19	A1XJ49	7.01e-21	85.1	139	0.301	0.360	A1XJ49_GOSHI Actin depolymerizing factor 6 OS=Gossypium hirsutum OX=3635 GN=ADF6 PE=2 SV=1
20	Q4JHK7	1.46e-20	84.3	139	0.301	0.360	Q4JHK7_GOSHI Actin depolymerizing factor OS=Gossypium hirsutum OX=3635 GN=ADF1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00241 Cofilin_ADF	2.3e-28	109.8	Cofilin/tropomyosin-type actin-binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 225400.XP_006771640.1

Rank	PPI partner	STRING score	Description
1	225400.XP_006773475.1	0.998	LIM domain kinase 1
2	225400.XP_006765504.1	0.985	Actin, cytoplasmic 1
3	225400.XP_006762149.1	0.984	LIM domain kinase 2 isoform X1
4	225400.XP_006762176.1	0.982	Protein phosphatase Slingshot homolog 1
5	225400.XP_006768128.1	0.958	Protein phosphatase Slingshot like protein 2
6	225400.XP_006771744.1	0.958	Protein phosphatase Slingshot homolog 3
7	225400.XP_006771960.1	0.948	Profilin-1
8	225400.XP_006758032.1	0.932	Adenylyl cyclase-associated protein 1 isoform X1
9	225400.XP_006764135.1	0.921	Adenylyl cyclase-associated protein 2
10	225400.XP_006753072.1	0.871	Actin, cytoplasmic 2
11	225400.XP_006756803.1	0.853	WD repeat-containing protein 1-like
12	225400.XP_006766646.1	0.853	WD repeat-containing protein 1
13	225400.XP_006759773.1	0.834	Cofilin-2
14	225400.XP_006760347.1	0.795	Belongs to the 14-3-3 family.
15	225400.XP_006770511.1	0.770	Transforming protein RhoA
16	225400.XP_006778593.1	0.769	ARP2 actin related protein 2 homolog
17	225400.XP_006753156.1	0.766	Src substrate cortactin
18	225400.XP_006760090.1	0.761	Actin, gamma-enteric smooth muscle
19	225400.XP_006755974.1	0.736	Profilin-4-like
20	225400.XP_006759146.1	0.736	Profilin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051015	1.000	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071840	0.985	cellular component organization or biogenesis
GO:0016043	0.984	cellular component organization
GO:0065007	0.969	biological regulation
GO:0050789	0.958	regulation of biological process
GO:0050794	0.950	regulation of cellular process
GO:0030029	0.948	actin filament-based process
GO:0022411	0.943	cellular component disassembly
GO:0030036	0.935	actin cytoskeleton organization
GO:0043933	0.841	protein-containing complex organization
GO:0051261	0.826	protein depolymerization
GO:0008154	0.817	actin polymerization or depolymerization
GO:0030042	0.808	actin filament depolymerization
GO:0048518	0.727	positive regulation of biological process
GO:0051128	0.700	regulation of cellular component organization
GO:0050896	0.652	response to stimulus
GO:0048522	0.634	positive regulation of cellular process
GO:0032501	0.547	multicellular organismal process
GO:0032502	0.440	developmental process
GO:0048856	0.432	anatomical structure development
GO:0065008	0.418	regulation of biological quality
GO:0048519	0.405	negative regulation of biological process
GO:0048523	0.401	negative regulation of cellular process
GO:0008152	0.356	metabolic process
GO:0051716	0.345	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0005576	0.997	extracellular region
GO:0031982	0.996	vesicle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0005829	0.991	cytosol
GO:0016020	0.989	membrane
GO:0005615	0.989	extracellular space
GO:0043230	0.987	extracellular organelle
GO:0071944	0.983	cell periphery
GO:0070161	0.977	anchoring junction
GO:0005634	0.971	nucleus
GO:0005886	0.955	plasma membrane
GO:0070062	0.955	extracellular exosome
GO:0005925	0.852	focal adhesion
GO:0005856	0.837	cytoskeleton
GO:0015629	0.677	actin cytoskeleton
GO:0070013	0.550	intracellular organelle lumen
GO:0012505	0.490	endomembrane system
GO:0042995	0.483	cell projection
GO:0120025	0.471	plasma membrane bounded cell projection
GO:0031981	0.443	nuclear lumen
GO:0005938	0.400	cell cortex
GO:0031252	0.330	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]