StarFunc result for job id P23582

User Input

>input (126 residues)
MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGG
GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS
MSGLGC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23582	1.000	1.000	9.406E-19	126	1.000	1.000	P23582.pdb.gz	ANFC_HUMAN C-type natriuretic peptide OS=Homo sapiens OX=9606 GN=NPPC PE=1 SV=1
2	AFDB:Q9VJC1	0.228	0.141	1.181	232	0.190	0.103	Q9VJC1.pdb.gz	Q9VJC1_DROME GH17679p OS=Drosophila melanogaster OX=7227 GN=Oli PE=2 SV=1
3	AFDB:Q9BVV8	0.262	0.251	1.458	132	0.214	0.205	Q9BVV8.pdb.gz	F174C_HUMAN Protein FAM174C OS=Homo sapiens OX=9606 GN=FAM174C PE=1 SV=2
4	AFDB:P39013	0.179	0.080	2.071	349	0.087	0.032	P39013.pdb.gz	END3_YEAST Actin cytoskeleton-regulatory complex protein END3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=END3 PE=1 SV=1
5	AFDB:Q9ER04	0.195	0.075	2.384	455	0.143	0.040	Q9ER04.pdb.gz	TMPS5_MOUSE Transmembrane protease serine 5 OS=Mus musculus OX=10090 GN=Tmprss5 PE=2 SV=3
6	AFDB:P53718	0.199	0.114	2.557	249	0.143	0.072	P53718.pdb.gz	NRM1_YEAST Transcription factor NRM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NRM1 PE=1 SV=1
7	AFDB:D4YW53	0.224	0.078	3.158	486	0.159	0.041	D4YW53.pdb.gz	D4YW53_CAEEL K Homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=asd-2 PE=1 SV=2
8	AFDB:Q9LEU9	0.300	0.100	3.158	434	0.079	0.023	Q9LEU9.pdb.gz	Q9LEU9_ARATH AT5g10910/T30N20_180 OS=Arabidopsis thaliana OX=3702 GN=CMAL PE=1 SV=1
9	PDB:7ajtCL	0.251	0.046	3.821	781	0.103	0.017	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
10	AFDB:Q68D86	0.202	0.080	3.899	513	0.127	0.031	Q68D86.pdb.gz	C102B_HUMAN Coiled-coil domain-containing protein 102B OS=Homo sapiens OX=9606 GN=CCDC102B PE=1 SV=4
11	AFDB:Q02209	0.294	0.137	4.487	353	0.127	0.045	Q02209.pdb.gz	YKZ1_YEAST Uncharacterized protein YKR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKR011C PE=1 SV=2
12	PDB:6qx91K	0.223	0.148	5.061	201	0.143	0.090	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
13	PDB:7ajuCL	0.251	0.043	6.249	808	0.095	0.015	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:7d4iRJ	0.170	0.041	6.249	738	0.135	0.023	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23582	1.56e-85	246	126	1.000	1.000	ANFC_HUMAN C-type natriuretic peptide OS=Homo sapiens OX=9606 GN=NPPC PE=1 SV=1
2	P55207	6.67e-71	209	126	0.937	0.937	ANFC_RAT C-type natriuretic peptide OS=Rattus norvegicus OX=10116 GN=Nppc PE=2 SV=1
3	Q61839	9.28e-69	204	126	0.913	0.913	ANFC_MOUSE C-type natriuretic peptide OS=Mus musculus OX=10090 GN=Nppc PE=3 SV=1
4	P84715	6.08e-31	108	121	0.571	0.595	ANF39_ORNAN C-type natriuretic peptide OS=Ornithorhynchus anatinus OX=9258 PE=1 SV=2
5	Q27J49	1.41e-12	63.9	239	0.365	0.192	BNP_LACMU Bradykinin-potentiating and C-type natriuretic peptides OS=Lachesis muta muta OX=8753 PE=1 SV=1
6	Q9PW56	2.43e-12	63.5	265	0.294	0.140	BNP2_BOTJA Bradykinin-potentiating and C-type natriuretic peptides OS=Bothrops jararaca OX=8724 PE=1 SV=2
7	Q6LEM5	9.18e-11	59.3	256	0.278	0.137	BNP1_BOTJA Bradykinin-potentiating and C-type natriuretic peptides OS=Bothrops jararaca OX=8724 PE=1 SV=1
8	A0A060XWG0	1.55e-07	48.9	131	0.190	0.183	A0A060XWG0_ONCMY C-type natriuretic peptide 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00030908001 PE=3 SV=1
9	Q8AXR3	1.55e-07	48.9	131	0.190	0.183	ANFC1_ONCMY C-type natriuretic peptide 1 OS=Oncorhynchus mykiss OX=8022 GN=cnp-1 PE=2 SV=1
10	D9IX97	3.32e-07	48.5	165	0.246	0.188	VNP_NAJAT Natriuretic peptide Na-NP OS=Naja atra OX=8656 PE=1 SV=1
11	B3EWY3	2.73e-06	43.1	32	0.159	0.625	BNPL1_CROOA Natriuretic peptide Coa_NP1 OS=Crotalus oreganus abyssus OX=128077 PE=1 SV=1
12	B3EWY2	2.97e-06	43.1	32	0.151	0.594	BNPL2_CROOA Natriuretic peptide Coa_NP2 OS=Crotalus oreganus abyssus OX=128077 PE=1 SV=1
13	F1R8L8	1.12e-05	43.9	129	0.190	0.186	F1R8L8_DANRE Natriuretic peptide B OS=Danio rerio OX=7955 GN=si:ch211-215j19.10 PE=3 SV=1
14	P82972	8.43e-04	37.0	37	0.135	0.459	VNP_PSEPC Natriuretic peptide PNP OS=Pseudocerastes persicus OX=47769 PE=1 SV=1
15	Q78AW6	0.004	37.0	148	0.151	0.128	Q78AW6_SALSA Cardiac peptide OS=Salmo salar OX=8030 PE=3 SV=1
16	P18908	0.005	36.6	140	0.103	0.093	ANF_CHICK Natriuretic peptides A OS=Gallus gallus OX=9031 GN=NPPA PE=1 SV=2
17	Q9YGJ1	0.005	37.0	152	0.151	0.125	Q9YGJ1_SALSA Cardiac hormone OS=Salmo salar OX=8030 GN=LOC100136387 PE=2 SV=1
18	P16860	0.022	35.0	134	0.111	0.104	ANFB_HUMAN Natriuretic peptides B OS=Homo sapiens OX=9606 GN=NPPB PE=1 SV=1
19	F1QVW0	0.038	34.3	139	0.135	0.122	F1QVW0_DANRE Natriuretic peptide A OS=Danio rerio OX=7955 GN=anf PE=1 SV=1
20	P13205	0.051	33.9	121	0.111	0.116	ANFB_RAT Natriuretic peptides B OS=Rattus norvegicus OX=10116 GN=Nppb PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00212 ANP	1.4e-11	55.7	Atrial natriuretic peptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387159

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341083	0.999	Atrial natriuretic peptide receptor 2
2	9606.ENSP00000265074	0.994	Atrial natriuretic peptide receptor 3
3	9606.ENSP00000357669	0.973	Atrial natriuretic peptide receptor 1
4	9606.ENSP00000365663	0.842	Natriuretic peptides A
5	9606.ENSP00000365651	0.759	Natriuretic peptides B
6	9606.ENSP00000314508	0.732	Glucosylceramidase that catalyzes, within the lysosomal compartment, the hydrolysis of glucosylceramide/GlcCer into free ceramide and glucose . Thereby, plays a central role in the degradation of complex lipids and the turnover of cellular membranes . Through the production of ceramides, participates to the PKC-activated salvage pathway of ceramide formation . Also plays a role in cholesterol metabolism . May either catalyze the glucosylation of cholesterol, through a transglucosylation reaction that transfers glucose from glucosylceramide to cholesterol . The short chain saturated C8: [...]
7	9606.ENSP00000339824	0.725	Fibroblast growth factor receptor 3
8	9606.ENSP00000368683	0.681	Endothelin-1
9	9606.ENSP00000418525	0.676	Neprilysin
10	9606.ENSP00000377470	0.653	2',3'-cyclic-nucleotide 3'-phosphodiesterase
11	9606.ENSP00000394842	0.652	Grancalcin
12	9606.ENSP00000261170	0.614	Heat-stable enterotoxin receptor
13	9606.ENSP00000363092	0.609	cGMP-dependent protein kinase 1
14	9606.ENSP00000261654	0.605	Adhesion G-protein coupled receptor D1
15	9606.ENSP00000272190	0.602	Renin
16	9606.ENSP00000386928	0.602	Serine/threonine-protein kinase 16
17	9606.ENSP00000265260	0.585	PEST proteolytic signal-containing nuclear protein
18	9606.ENSP00000349493	0.583	Guanylin
19	9606.ENSP00000250111	0.577	Sodium/potassium-transporting ATPase subunit beta-2
20	9606.ENSP00000356581	0.577	Adhesion G-protein coupled receptor G6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	0.998	hormone activity
GO:0051427	0.995	hormone receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.975	cellular process
GO:0050789	0.975	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0050896	0.965	response to stimulus
GO:0071704	0.965	organic substance metabolic process
GO:0044238	0.958	primary metabolic process
GO:0051239	0.941	regulation of multicellular organismal process
GO:0007154	0.940	cell communication
GO:0044237	0.939	cellular metabolic process
GO:0032501	0.938	multicellular organismal process
GO:0023052	0.936	signaling
GO:0006807	0.932	nitrogen compound metabolic process
GO:0051716	0.900	cellular response to stimulus
GO:0048523	0.875	negative regulation of cellular process
GO:1901564	0.872	organonitrogen compound metabolic process
GO:0009187	0.872	cyclic nucleotide metabolic process
GO:0007165	0.869	signal transduction
GO:0050793	0.858	regulation of developmental process
GO:0052652	0.831	cyclic purine nucleotide metabolic process
GO:0007166	0.829	cell surface receptor signaling pathway
GO:0007167	0.818	enzyme-linked receptor protein signaling pathway
GO:0045595	0.804	regulation of cell differentiation
GO:0009150	0.798	purine ribonucleotide metabolic process
GO:0051047	0.797	positive regulation of secretion
GO:0009190	0.793	cyclic nucleotide biosynthetic process
GO:0045786	0.787	negative regulation of cell cycle
GO:0009152	0.737	purine ribonucleotide biosynthetic process
GO:0048522	0.734	positive regulation of cellular process
GO:0048583	0.720	regulation of response to stimulus
GO:1903532	0.701	positive regulation of secretion by cell
GO:0019222	0.685	regulation of metabolic process
GO:0043302	0.670	positive regulation of leukocyte degranulation
GO:0050865	0.590	regulation of cell activation
GO:1903429	0.570	regulation of cell maturation
GO:0051093	0.568	negative regulation of developmental process
GO:0043304	0.568	regulation of mast cell degranulation
GO:2000241	0.558	regulation of reproductive process
GO:0080090	0.518	regulation of primary metabolic process
GO:0060255	0.518	regulation of macromolecule metabolic process
GO:0051445	0.509	regulation of meiotic cell cycle
GO:0051171	0.507	regulation of nitrogen compound metabolic process
GO:0032502	0.506	developmental process
GO:0048856	0.502	anatomical structure development
GO:0023051	0.461	regulation of signaling
GO:0010646	0.450	regulation of cell communication
GO:0003008	0.437	system process
GO:0045596	0.433	negative regulation of cell differentiation
GO:0051240	0.403	positive regulation of multicellular organismal process
GO:0007275	0.402	multicellular organism development
GO:0065008	0.389	regulation of biological quality
GO:0042221	0.379	response to chemical
GO:0009966	0.378	regulation of signal transduction
GO:0031323	0.314	regulation of cellular metabolic process
GO:0003013	0.306	circulatory system process
GO:0008015	0.302	blood circulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0032991	0.970	protein-containing complex
GO:0005622	0.957	intracellular anatomical structure
GO:0005737	0.935	cytoplasm
GO:0043226	0.912	organelle
GO:0043227	0.878	membrane-bounded organelle
GO:0043231	0.836	intracellular membrane-bounded organelle
GO:0012505	0.596	endomembrane system
GO:0005615	0.538	extracellular space
GO:0016020	0.509	membrane
GO:0071944	0.506	cell periphery
GO:0031982	0.483	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]