StarFunc result for job id P23610

User Input

>input (371 residues)
MAAAAAGLGGGGAGPGPEAGDFLARYRLVSNKLKKRFLRKPNVAEAGEQFGQLGRELRAQ
ECLPYAAWCQLAVARCQQALFHGPGEALALTEAARLFLRQERDARQRLVCPAAYGEPLQA
AASALGAAVRLHLELGQPAAAAALCLELAAALRDLGQPAAAAGHFQRAAQLQLPQLPLAA
LQALGEAASCQLLARDYTGALAVFTRMQRLAREHGSHPVQSLPPPPPPAPQPGPGATPAL
PAALLPPNSGSAAPSPAALGAFSDVLVRCEVSRVLLLLLLQPPPAKLLPEHAQTLEKYSW
EAFDSHGQESSGQLPEELFLLLQSLVMATHEKDTEAIKSLQVEMWPLLTAEQNHLLHLVL
QETISPSGQGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23610	1.000	1.000	1.984E-46	371	1.000	1.000	P23610.pdb.gz	HAP40_HUMAN 40-kDa huntingtin-associated protein OS=Homo sapiens OX=9606 GN=F8A1 PE=1 SV=2
2	AFDB:M0RDU0	0.858	0.836	1.113E-38	381	0.860	0.837	M0RDU0.pdb.gz	HAP40_RAT 40-kDa huntingtin-associated protein OS=Rattus norvegicus OX=10116 GN=F8a1 PE=1 SV=1
3	PDB:6ez8B	0.695	0.954	3.564E-26	268	0.720	0.996	6ez8B.pdb.gz
4	AFDB:A1L245	0.621	0.762	4.324E-9	295	0.146	0.183	A1L245.pdb.gz	A1L245_DANRE Zgc:158643 OS=Danio rerio OX=7955 GN=zgc:158643 PE=2 SV=1
5	AFDB:P54920	0.605	0.742	1.348E-8	295	0.127	0.159	P54920.pdb.gz	SNAA_HUMAN Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3
6	AFDB:Q9VXR6	0.607	0.647	1.831E-8	345	0.216	0.232	Q9VXR6.pdb.gz	Q9VXR6_DROME GH09650p OS=Drosophila melanogaster OX=7227 GN=Hap40 PE=1 SV=1
7	AFDB:Q4GYR2	0.564	0.715	1.998E-8	281	0.154	0.203	Q4GYR2.pdb.gz	Q4GYR2_TRYB2 Soluble N-ethylmaleimide sensitive factor (NSF) attachment protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3110 PE=3 SV=1
8	AFDB:Q9SPE6	0.595	0.743	3.232E-8	289	0.146	0.187	Q9SPE6.pdb.gz	SNAA2_ARATH Alpha-soluble NSF attachment protein 2 OS=Arabidopsis thaliana OX=3702 GN=ASNAP2 PE=1 SV=1
9	AFDB:P28663	0.617	0.753	3.528E-8	298	0.140	0.174	P28663.pdb.gz	SNAB_MOUSE Beta-soluble NSF attachment protein OS=Mus musculus OX=10090 GN=Napb PE=1 SV=2
10	AFDB:Q23983	0.619	0.764	3.685E-8	292	0.129	0.164	Q23983.pdb.gz	SNAP_DROME Alpha-soluble NSF attachment protein OS=Drosophila melanogaster OX=7227 GN=alphaSnap PE=1 SV=1
11	AFDB:P32602	0.619	0.769	1.008E-7	292	0.151	0.192	P32602.pdb.gz	SEC17_YEAST Alpha-soluble NSF attachment protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC17 PE=1 SV=4
12	PDB:1qqeA	0.594	0.758	2.576E-7	281	0.137	0.181	1qqeA.pdb.gz
13	PDB:6ip1E	0.570	0.704	1.339E-4	292	0.119	0.151	6ip1E.pdb.gz
14	PDB:5mpbQ	0.359	0.315	1.484E-3	434	0.092	0.078	5mpbQ.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
15	PDB:6yj6A	0.353	0.194	4.239E-3	819	0.140	0.063	6yj6A.pdb.gz
16	PDB:7dkhI	0.222	0.104	4.239E-3	914	0.121	0.049	7dkhI.pdb.gz
17	PDB:4gyoB	0.283	0.290	5.511E-3	359	0.108	0.111	4gyoB.pdb.gz	Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
18	PDB:7qe7U	0.147	0.110	5.511E-3	540	0.129	0.089	7qe7U.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:3q15A	0.299	0.304	5.757E-3	365	0.143	0.145	3q15A.pdb.gz	Structural basis of response regulator dephosphorylation by Rap phosphatases.
20	PDB:8a3tJ	0.206	0.160	6.014E-3	509	0.129	0.094	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0RDU0	0.0	516	381	0.863	0.840	HAP40_RAT 40-kDa huntingtin-associated protein OS=Rattus norvegicus OX=10116 GN=F8a1 PE=1 SV=1
2	P23610	0.0	717	371	1.000	1.000	HAP40_HUMAN 40-kDa huntingtin-associated protein OS=Homo sapiens OX=9606 GN=F8A1 PE=1 SV=2
3	Q00558	0.0	517	381	0.868	0.845	HAP40_MOUSE 40-kDa huntingtin-associated protein OS=Mus musculus OX=10090 GN=F8a1 PE=1 SV=2
4	Q10135	8.1	31.2	1273	0.075	0.022	LSD2_SCHPO Lysine-specific histone demethylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsd2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14938 SNAP	0.032	25.3	Soluble NSF attachment protein, SNAP
2	PF07719 TPR_2	1.1e+02	14.3	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479624

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347184	0.851	Huntingtin
2	9606.ENSP00000358518	0.800	Coagulation factor VIII-associated 2
3	9606.ENSP00000477530	0.800	Coagulation factor VIII-associated 3
4	9606.ENSP00000353393	0.700	Coagulation factor VIII
5	9606.ENSP00000358474	0.502	Lys-63-specific deubiquitinase BRCC36

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0048519	0.980	negative regulation of biological process
GO:0080090	0.980	regulation of primary metabolic process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0051246	0.973	regulation of protein metabolic process
GO:0009894	0.968	regulation of catabolic process
GO:1903050	0.920	regulation of proteolysis involved in protein catabolic process
GO:0042176	0.919	regulation of protein catabolic process
GO:0009892	0.911	negative regulation of metabolic process
GO:0009987	0.893	cellular process
GO:0010605	0.841	negative regulation of macromolecule metabolic process
GO:0042177	0.825	negative regulation of protein catabolic process
GO:0061136	0.823	regulation of proteasomal protein catabolic process
GO:0045861	0.783	negative regulation of proteolysis
GO:1903051	0.765	negative regulation of proteolysis involved in protein catabolic process
GO:0050794	0.543	regulation of cellular process
GO:1901799	0.503	negative regulation of proteasomal protein catabolic process
GO:0051179	0.434	localization
GO:0051234	0.407	establishment of localization
GO:0051641	0.370	cellular localization
GO:0006810	0.350	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.998	endomembrane system
GO:0005654	0.998	nucleoplasm
GO:0031982	0.927	vesicle
GO:0031410	0.919	cytoplasmic vesicle
GO:0005768	0.909	endosome
GO:0005769	0.873	early endosome
GO:0016020	0.870	membrane
GO:0031090	0.766	organelle membrane
GO:0005829	0.301	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]