StarFunc result for job id P23634

User Input

>input (1241 residues)
MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKT
SPVEGLSGNPADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLS
FYRPAGEENELCGQVATTPEDENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGL
QCRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLT
GESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIILTLLGVNEDDEGEKKKK
GKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKSVLQGKLTRLA
VQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVKFFIIGITVLVVA
VPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQA
YIGGIHYRQIPSPDVFLPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGNKTECALL
GFVTDLKQDYQAVRNEVPEEKLYKVYTFNSVRKSMSTVIRNPNGGFRMYSKGASEIILRK
CNRILDRKGEAVPFKNKDRDDMVRTVIEPMACDGLRTICIAYRDFDDTEPSWDNENEILT
ELTCIAVVGIEDPVRPEVPDAIAKCKQAGITVRMVTGDNINTARAIATKCGILTPGDDFL
CLEGKEFNRLIRNEKGEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGEHRQVV
AVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI
SKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLL
KRRPYGRNKPLISRTMMKNILGHAFYQLIVIFILVFAGEKFFDIDSGRKAPLHSPPSQHY
TIVFNTFVLMQLFNEINSRKIHGEKNVFSGIYRNIIFCSVVLGTFICQIFIVEFGGKPFS
CTSLSLSQWLWCLFIGIGELLWGQFISAIPTRSLKFLKEAGHGTTKEEITKDAEGLDEID
HAEMELRRGQILWFRGLNRIQTQIDVINTFQTGASFKGVLRRQNMGQHLDVKLVPSSSYI
KVVKAFHSSLHESIQKPYNQKSIHSFMTHPEFAIEEELPRTPLLDEEEEENPDKASKFGT
RVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7CED8	0.804	0.852	0.000	1170	0.546	0.579	B7CED8.pdb.gz	B7CED8_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=mca-3 PE=1 SV=1
2	AFDB:F6PDY7	0.859	0.868	0.000	1228	0.721	0.729	F6PDY7.pdb.gz	F6PDY7_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=pmca1 PE=1 SV=1
3	AFDB:G5EFR6	0.792	0.785	0.000	1252	0.492	0.488	G5EFR6.pdb.gz	MCA1_CAEEL Plasma membrane calcium-transporting ATPase mca-1 OS=Caenorhabditis elegans OX=6239 GN=mca-1 PE=1 SV=1
4	AFDB:P11506	0.847	0.846	0.000	1243	0.718	0.717	P11506.pdb.gz	AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus OX=10116 GN=Atp2b2 PE=1 SV=2
5	AFDB:P23634	1.000	1.000	0.000	1241	1.000	1.000	P23634.pdb.gz	AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens OX=9606 GN=ATP2B4 PE=1 SV=2
6	AFDB:Q6Q477	0.859	0.884	0.000	1205	0.821	0.846	Q6Q477.pdb.gz	AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus OX=10090 GN=Atp2b4 PE=1 SV=1
7	AFDB:Q95XP5	0.803	0.808	0.000	1234	0.562	0.565	Q95XP5.pdb.gz	Q95XP5_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=mca-3 PE=1 SV=1
8	AFDB:Q9R0K7	0.838	0.868	0.000	1198	0.714	0.740	Q9R0K7.pdb.gz	AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus OX=10090 GN=Atp2b2 PE=1 SV=2
9	PDB:6a69A	0.685	0.924	6.564E-96	911	0.606	0.825	6a69A.pdb.gz
10	AFDB:Q9LF79	0.681	0.780	6.875E-84	1074	0.333	0.385	Q9LF79.pdb.gz	ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA8 PE=1 SV=1
11	AFDB:J9VQQ3	0.706	0.623	4.101E-80	1414	0.343	0.301	J9VQQ3.pdb.gz	ATC2_CRYNH Calcium-transporting ATPase 2 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=PMC1 PE=3 SV=1
12	PDB:7e7sA	0.589	0.703	6.946E-54	1020	0.230	0.280	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
13	PDB:5zmwA	0.565	0.686	8.379E-53	1000	0.222	0.276	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
14	PDB:8d3xA	0.500	0.608	1.901E-46	989	0.208	0.261	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
15	PDB:7x20A	0.489	0.598	2.365E-46	986	0.207	0.261	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
16	PDB:3ixzA	0.495	0.601	1.222E-43	998	0.197	0.245	3ixzA.pdb.gz
17	PDB:3b8eA	0.494	0.598	4.337E-43	998	0.219	0.273	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.
18	PDB:7vh5A	0.470	0.688	3.065E-36	804	0.157	0.243	7vh5A.pdb.gz
19	PDB:7vpkA	0.441	0.508	3.225E-32	1055	0.152	0.179	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
20	PDB:7m5xA	0.415	0.496	1.772E-31	1000	0.153	0.190	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A2QQN0	620	1433	0.337	0.292	A2QQN0_ASPNC Calcium-transporting ATPase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An08g03090 PE=3 SV=1
2	B7CED8	1316	1170	0.550	0.584	B7CED8_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=mca-3 PE=1 SV=1
3	D6XMU9	582	1080	0.311	0.357	D6XMU9_TRYB2 Calcium-transporting ATPase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.350 PE=3 SV=1
4	E6EK15	1375	1194	0.579	0.602	E6EK15_DROME Calcium-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=PMCA PE=1 SV=1
5	E6EK17	1379	1187	0.580	0.607	E6EK17_DROME Calcium-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=PMCA PE=1 SV=1
6	E6EK18	1375	1210	0.582	0.597	E6EK18_DROME Calcium-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=PMCA PE=1 SV=1
7	F6PDY7	1715	1228	0.707	0.714	F6PDY7_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=pmca1 PE=1 SV=1
8	F7AAP4	1998	1166	0.795	0.846	F7AAP4_MOUSE Calcium-transporting ATPase OS=Mus musculus OX=10090 GN=Atp2b4 PE=1 SV=1
9	G5E829	1799	1220	0.727	0.739	AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus OX=10090 GN=Atp2b1 PE=1 SV=1
10	G5EFR6	1160	1252	0.498	0.494	MCA1_CAEEL Plasma membrane calcium-transporting ATPase mca-1 OS=Caenorhabditis elegans OX=6239 GN=mca-1 PE=1 SV=1
11	O22218	672	1030	0.342	0.412	ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA4 PE=1 SV=1
12	O64806	656	1015	0.337	0.412	ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA7 PE=3 SV=2
13	O81108	661	1014	0.340	0.416	ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA2 PE=1 SV=1
14	P11505	1799	1220	0.727	0.739	AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp2b1 PE=1 SV=3
15	P11506	1766	1243	0.721	0.720	AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus OX=10116 GN=Atp2b2 PE=1 SV=2
16	P20020	1785	1220	0.726	0.739	AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4
17	P23634	2559	1241	1.000	1.000	AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens OX=9606 GN=ATP2B4 PE=1 SV=2
18	P54678	688	1115	0.359	0.399	ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum OX=44689 GN=patA PE=1 SV=2
19	Q01814	1769	1243	0.722	0.721	AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2B2 PE=1 SV=2
20	Q16720	1818	1220	0.721	0.734	AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens OX=9606 GN=ATP2B3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12424 ATP_Ca_trans_C	7.9e-31	117.6	Plasma membrane calcium transporter ATPase C terminal
2	PF13246 Cation_ATPase	9.5e-17	72.2	Cation transport ATPase (P-type)
3	PF00689 Cation_ATPase_C	3.3e-41	152.5	Cation transporting ATPase, C-terminus
4	PF00690 Cation_ATPase_N	3.2e-14	63.7	Cation transporter/ATPase, N-terminus
5	PF00122 E1-E2_ATPase	1.4e-30	117.7	E1-E2 ATPase
6	PF00702 Hydrolase	1.1e-11	57.0	haloacid dehalogenase-like hydrolase
7	PF08282 Hydrolase_3	0.002	29.5	haloacid dehalogenase-like hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008974847.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003832698.1	0.884	Nitric oxide synthase, brain
2	9597.XP_003814910.1	0.808	Belongs to the protein kinase superfamily.
3	9597.XP_003824803.1	0.808	Belongs to the protein kinase superfamily.
4	9597.XP_008967631.1	0.808	Belongs to the protein kinase superfamily.
5	9597.XP_003806380.1	0.807	Protein kinase, cGMP-dependent, type I
6	9597.XP_003832316.1	0.807	Protein kinase, cGMP-dependent, type II
7	9597.XP_008975309.1	0.804	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium.
8	9597.XP_003804426.1	0.760	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1-like
9	9597.XP_008956436.1	0.760	Tetratricopeptide repeat domain 7B
10	9597.XP_003817536.1	0.747	Belongs to the calmodulin family.
11	9597.XP_008974499.1	0.747	Calmodulin
12	9597.XP_008965725.1	0.743	Alpha-1-syntrophin
13	9597.XP_008964926.1	0.723	RAN binding protein 1
14	9597.XP_003810549.1	0.716	Renalase, FAD dependent amine oxidase
15	9597.XP_008956435.1	0.705	Calmodulin isoform X1
16	9597.XP_003807165.1	0.688	Troponin I3, cardiac type
17	9597.XP_003826215.1	0.685	NF-kappa-B inhibitor-interacting Ras-like protein 1
18	9597.XP_008966187.1	0.674	Nitric oxide synthase 3
19	9597.XP_003810153.1	0.673	Belongs to the MAGUK family.
20	9597.XP_003827634.1	0.668	Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005388	0.999	P-type calcium transporter activity
GO:0019904	0.458	protein domain specific binding
GO:0097159	0.439	organic cyclic compound binding
GO:0005516	0.410	calmodulin binding
GO:0030165	0.390	PDZ domain binding
GO:0036094	0.358	small molecule binding
GO:0030554	0.346	adenyl nucleotide binding
GO:0043167	0.339	ion binding
GO:0019899	0.320	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.966	regulation of biological process
GO:0019725	0.922	cellular homeostasis
GO:0009987	0.916	cellular process
GO:0051179	0.914	localization
GO:0050801	0.901	monoatomic ion homeostasis
GO:0006811	0.899	monoatomic ion transport
GO:0050794	0.867	regulation of cellular process
GO:0030001	0.862	metal ion transport
GO:0055080	0.746	monoatomic cation homeostasis
GO:0071702	0.719	organic substance transport
GO:0032501	0.565	multicellular organismal process
GO:0098771	0.548	inorganic ion homeostasis
GO:0006816	0.470	calcium ion transport
GO:0055082	0.460	intracellular chemical homeostasis
GO:0030003	0.433	intracellular monoatomic cation homeostasis
GO:0006874	0.398	intracellular calcium ion homeostasis
GO:0048518	0.341	positive regulation of biological process
GO:0032879	0.315	regulation of localization
GO:0051049	0.313	regulation of transport
GO:0044057	0.310	regulation of system process
GO:0050896	0.303	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.871	organelle
GO:0005622	0.837	intracellular anatomical structure
GO:0043231	0.797	intracellular membrane-bounded organelle
GO:0005737	0.647	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18105	0.999	ATP + Ca(2+)(in) + H2O = ADP + Ca(2+)(out) + H(+) + phosphate
EC:7.2.2.10	0.999	P-type Ca(2+) transporter.

[back to server]