StarFunc result for job id P23677

User Input

>input (461 residues)
MTLPGGPTGMARPGGARPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAK
RRGGQVPNGLPRAPPAPVIPQLTVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRL
STSSVSSTGSSSLLEDSEDDLLSDSESRSRGNVQLEAGEDVGQKNHWQKIRTMVNLPVIS
PFKKRYAWVQLAGHTGSFKAAGTSGLILKRCSEPERYCLARLMADALRGCVPAFHGVVER
DGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAP
TEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVLRVFE
EFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKT
TPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23677	1.000	1.000	9.139E-79	461	1.000	1.000	P23677.pdb.gz	IP3KA_HUMAN Inositol-trisphosphate 3-kinase A OS=Homo sapiens OX=9606 GN=ITPKA PE=1 SV=1
2	AFDB:Q9VYE6	0.617	0.429	5.147E-39	669	0.438	0.302	Q9VYE6.pdb.gz	Q9VYE6_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=IP3K2 PE=2 SV=2
3	AFDB:Q95R55	0.554	0.578	1.825E-31	441	0.302	0.315	Q95R55.pdb.gz	Q95R55_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=IP3K1 PE=2 SV=1
4	PDB:2iewA	0.391	0.679	1.798E-13	258	0.126	0.225	2iewA.pdb.gz	Crystal structure of inositol phosphate multikinase 2 and implications for substrate specificity.
5	AFDB:Q57X56	0.379	0.239	1.226E-11	756	0.200	0.122	Q57X56.pdb.gz	Q57X56_TRYB2 Kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.1100 PE=3 SV=1
6	PDB:4frfA	0.306	0.628	1.268E-8	214	0.091	0.196	4frfA.pdb.gz
7	PDB:1bo1A	0.211	0.280	1.849E-1	326	0.076	0.107	1bo1A.pdb.gz
8	PDB:4lv7A	0.158	0.181	1.954E-1	390	0.093	0.110	4lv7A.pdb.gz	Conformational stability of inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1) dictates its substrate selectivity.
9	PDB:4oauC	0.088	0.060	1.954E-1	692	0.052	0.035	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
10	AFDB:E9ADC3	0.107	0.081	2.730E-1	642	0.113	0.081	E9ADC3.pdb.gz	E9ADC3_LEIMA Choline kinase OS=Leishmania major OX=5664 GN=LMJF_27_1420 PE=4 SV=1
11	PDB:3eqdA	0.072	0.096	3.047E-1	315	0.037	0.054	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
12	PDB:6s73A	0.070	0.101	3.221E-1	269	0.046	0.078	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
13	PDB:5eymA	0.074	0.106	3.806E-1	292	0.035	0.055	5eymA.pdb.gz	Pharmacological Profile of BI 847325, an Orally Bioavailable, ATP-Competitive Inhibitor of MEK and Aurora Kinases.
14	PDB:7em5B	0.103	0.149	4.496E-1	297	0.041	0.064	7em5B.pdb.gz	The GTP responsiveness of PI5P4K beta evolved from a compromised trade-off between activity and specificity.
15	PDB:6oidA	0.089	0.132	5.024E-1	289	0.043	0.069	6oidA.pdb.gz	A redox-active switch in fructosamine-3-kinases expands the regulatory repertoire of the protein kinase superfamily.
16	AFDB:O08722	0.072	0.044	9.792E-1	945	0.121	0.059	O08722.pdb.gz	UNC5B_RAT Netrin receptor UNC5B OS=Rattus norvegicus OX=10116 GN=Unc5b PE=1 SV=1
17	AFDB:P48562	0.178	0.111	1.366	842	0.134	0.074	P48562.pdb.gz	CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLA4 PE=1 SV=1
18	AFDB:O95210	0.049	0.060	1.527	358	0.106	0.137	O95210.pdb.gz	STBD1_HUMAN Starch-binding domain-containing protein 1 OS=Homo sapiens OX=9606 GN=STBD1 PE=1 SV=1
19	AFDB:Q9VXK1	0.087	0.078	1.527	519	0.087	0.077	Q9VXK1.pdb.gz	Q9VXK1_DROME Defective proboscis extension response 18 OS=Drosophila melanogaster OX=7227 GN=dpr18 PE=2 SV=2
20	AFDB:P25119	0.060	0.059	1.706	474	0.085	0.082	P25119.pdb.gz	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17105	0.0	804	459	0.935	0.939	IP3KA_RAT Inositol-trisphosphate 3-kinase A OS=Rattus norvegicus OX=10116 GN=Itpka PE=1 SV=3
2	P23677	0.0	939	461	1.000	1.000	IP3KA_HUMAN Inositol-trisphosphate 3-kinase A OS=Homo sapiens OX=9606 GN=ITPKA PE=1 SV=1
3	Q8R071	0.0	802	459	0.933	0.937	IP3KA_MOUSE Inositol-trisphosphate 3-kinase A OS=Mus musculus OX=10090 GN=Itpka PE=1 SV=1
4	B2RXC2	7.19e-138	421	942	0.471	0.230	B2RXC2_MOUSE Kinase OS=Mus musculus OX=10090 GN=Itpkb PE=1 SV=1
5	P27987	1.66e-136	417	946	0.464	0.226	IP3KB_HUMAN Inositol-trisphosphate 3-kinase B OS=Homo sapiens OX=9606 GN=ITPKB PE=1 SV=5
6	Q7TS72	3.07e-130	394	678	0.423	0.288	IP3KC_MOUSE Inositol-trisphosphate 3-kinase C OS=Mus musculus OX=10090 GN=Itpkc PE=1 SV=1
7	Q80ZG2	3.89e-130	393	678	0.425	0.289	IP3KC_RAT Inositol-trisphosphate 3-kinase C OS=Rattus norvegicus OX=10116 GN=Itpkc PE=1 SV=1
8	Q96DU7	2.90e-127	386	683	0.430	0.290	IP3KC_HUMAN Inositol-trisphosphate 3-kinase C OS=Homo sapiens OX=9606 GN=ITPKC PE=1 SV=1
9	Q9VYE7	1.07e-120	362	467	0.425	0.420	Q9VYE7_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=IP3K2 PE=1 SV=2
10	Q9VYE6	3.54e-119	365	669	0.386	0.266	Q9VYE6_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=IP3K2 PE=2 SV=2
11	Q7KV26	1.75e-117	361	691	0.386	0.258	Q7KV26_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=IP3K2 PE=3 SV=1
12	M9ND56	8.64e-67	218	318	0.262	0.381	M9ND56_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=IP3K1 PE=3 SV=1
13	Q9VL83	6.31e-66	220	441	0.262	0.274	Q9VL83_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=IP3K1 PE=2 SV=2
14	Q95R55	6.79e-66	220	441	0.262	0.274	Q95R55_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=IP3K1 PE=2 SV=1
15	Q55AP4	9.60e-12	68.2	307	0.152	0.228	Q55AP4_DICDI Kinase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271760 PE=3 SV=1
16	Q9VPR6	4.43e-10	63.2	309	0.156	0.233	Q9VPR6_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=Ipk2 PE=3 SV=2
17	Q8MRX9	1.60e-09	61.2	309	0.154	0.230	Q8MRX9_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=Ipk2 PE=2 SV=1
18	Q96PC2	1.89e-04	45.8	410	0.134	0.151	IP6K3_HUMAN Inositol hexakisphosphate kinase 3 OS=Homo sapiens OX=9606 GN=IP6K3 PE=1 SV=2
19	Q9US14	0.001	43.1	268	0.119	0.205	IPMK_SCHPO Inositol polyphosphate multikinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg82 PE=1 SV=1
20	Q7TT16	0.004	41.6	396	0.100	0.116	IPMK_MOUSE Inositol polyphosphate multikinase OS=Mus musculus OX=10090 GN=Ipmk PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03770 IPK	1.1e-37	141.4	Inositol polyphosphate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004392

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005160	0.995	Inositol polyphosphate-5-phosphatase J
2	61853.ENSNLEP00000002383	0.992	Inositol polyphosphate-5-phosphatase, 40kDa
3	61853.ENSNLEP00000014698	0.991	Multiple inositol-polyphosphate phosphatase 1
4	61853.ENSNLEP00000000930	0.987	Inositol polyphosphate-5-phosphatase K
5	61853.ENSNLEP00000014957	0.934	Kinase
6	61853.ENSNLEP00000024090	0.930	Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3.
7	61853.ENSNLEP00000016905	0.901	Kinase
8	61853.ENSNLEP00000023231	0.900	Kinase
9	61853.ENSNLEP00000010000	0.885	Inositol polyphosphate-5-phosphatase, 145kDa
10	61853.ENSNLEP00000020909	0.885	Inositol polyphosphate phosphatase-like 1
11	61853.ENSNLEP00000013112	0.882	Synaptojanin 2
12	61853.ENSNLEP00000014241	0.876	Inositol polyphosphate-5-phosphatase, 75kDa
13	61853.ENSNLEP00000018473	0.876	OCRL, inositol polyphosphate-5-phosphatase
14	61853.ENSNLEP00000004511	0.870	Synaptojanin 1
15	61853.ENSNLEP00000014741	0.866	Tumor suppressor. Acts as a dual-specificity protein phosphatase, dephosphorylating tyrosine-, serine- and threonine- phosphorylated proteins. Also acts as a lipid phosphatase.
16	61853.ENSNLEP00000003404	0.827	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
17	61853.ENSNLEP00000020702	0.827	Calmodulin 1 (phosphorylase kinase, delta)
18	61853.ENSNLEP00000007890	0.755	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
19	61853.ENSNLEP00000017309	0.694	Phospholipase C, beta 1 (phosphoinositide-specific)
20	61853.ENSNLEP00000020618	0.694	Calmodulin 2 (phosphorylase kinase, delta)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008440	1.000	inositol-1,4,5-trisphosphate 3-kinase activity
GO:0005515	0.960	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.987	cellular metabolic process
GO:0071704	0.986	organic substance metabolic process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0044238	0.981	primary metabolic process
GO:0009058	0.921	biosynthetic process
GO:0050896	0.920	response to stimulus
GO:0006793	0.900	phosphorus metabolic process
GO:1901576	0.897	organic substance biosynthetic process
GO:0065008	0.893	regulation of biological quality
GO:0090407	0.881	organophosphate biosynthetic process
GO:0006796	0.878	phosphate-containing compound metabolic process
GO:0006066	0.847	alcohol metabolic process
GO:0046486	0.847	glycerolipid metabolic process
GO:0051716	0.832	cellular response to stimulus
GO:0019751	0.823	polyol metabolic process
GO:0046488	0.819	phosphatidylinositol metabolic process
GO:0016043	0.809	cellular component organization
GO:0048518	0.775	positive regulation of biological process
GO:0022603	0.771	regulation of anatomical structure morphogenesis
GO:0046474	0.765	glycerophospholipid biosynthetic process
GO:0006661	0.762	phosphatidylinositol biosynthetic process
GO:0023052	0.742	signaling
GO:0051128	0.739	regulation of cellular component organization
GO:0048522	0.730	positive regulation of cellular process
GO:0007154	0.686	cell communication
GO:0051094	0.662	positive regulation of developmental process
GO:0010769	0.655	regulation of cell morphogenesis involved in differentiation
GO:0007165	0.646	signal transduction
GO:0051239	0.642	regulation of multicellular organismal process
GO:0042221	0.625	response to chemical
GO:0060998	0.607	regulation of dendritic spine development
GO:0010770	0.607	positive regulation of cell morphogenesis involved in differentiation
GO:2000026	0.602	regulation of multicellular organismal development
GO:0051130	0.599	positive regulation of cellular component organization
GO:0010646	0.580	regulation of cell communication
GO:0023051	0.566	regulation of signaling
GO:0120035	0.552	regulation of plasma membrane bounded cell projection organization
GO:0051240	0.550	positive regulation of multicellular organismal process
GO:0099175	0.539	regulation of postsynapse organization
GO:0106027	0.529	neuron projection organization
GO:0010975	0.529	regulation of neuron projection development
GO:1902074	0.477	response to salt
GO:0051960	0.470	regulation of nervous system development
GO:0099177	0.463	regulation of trans-synaptic signaling
GO:0061001	0.433	regulation of dendritic spine morphogenesis
GO:0043954	0.432	cellular component maintenance
GO:0031346	0.425	positive regulation of cell projection organization
GO:0050769	0.424	positive regulation of neurogenesis
GO:0050775	0.398	positive regulation of dendrite morphogenesis
GO:0060999	0.393	positive regulation of dendritic spine development
GO:0043647	0.355	inositol phosphate metabolic process
GO:1901700	0.354	response to oxygen-containing compound
GO:0070887	0.350	cellular response to chemical stimulus
GO:0010033	0.306	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0005829	0.989	cytosol
GO:0005856	0.950	cytoskeleton
GO:0043227	0.756	membrane-bounded organelle
GO:0043231	0.705	intracellular membrane-bounded organelle
GO:0016020	0.447	membrane
GO:0071944	0.342	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11020	1.000	1D-myo-inositol 1,4,5-trisphosphate + ATP = 1D-myo-inositol 1,3,4,5-tetrakisphosphate + ADP + H(+)
EC:2.7.1.127	1.000	inositol-trisphosphate 3-kinase.

[back to server]