StarFunc result for job id P23760

User Input

>input (479 residues)
MTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIV
EMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEE
YKRENPGMFSWEIRDKLLKDAVCDRNTVPSVSSISRILRSKFGKGEEEEADLERKEAEES
EKKAKHSIDGILSERASAPQSDEGSDIDSEPDLPLKRKQRRSRTTFTAEQLEELERAFER
THYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQAGANQLMAFNHLIPGGFPPTAMP
TLPTYQLSETSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNPDSSSAYCLPSTR
HGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLE
PTTTVSASCSQRLDHMKSLDSLPTSQSYCPPTYSTTGYSMDPVTGYQYGQYGQSKPWTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LMV3	0.477	0.473	6.410E-64	484	0.977	0.967	F1LMV3.pdb.gz	F1LMV3_RAT Paired box 3 OS=Rattus norvegicus OX=10116 GN=Pax3 PE=3 SV=2
2	AFDB:O57416	0.339	0.320	2.158E-51	509	0.781	0.735	O57416.pdb.gz	O57416_DANRE Paired box 3a OS=Danio rerio OX=7955 GN=pax3 PE=2 SV=1
3	AFDB:P23759	0.320	0.304	4.682E-49	505	0.760	0.721	P23759.pdb.gz	PAX7_HUMAN Paired box protein Pax-7 OS=Homo sapiens OX=9606 GN=PAX7 PE=1 SV=4
4	AFDB:O57419	0.301	0.296	7.733E-48	487	0.756	0.743	O57419.pdb.gz
5	AFDB:C0M005	0.526	0.495	1.371E-47	510	0.752	0.706	C0M005.pdb.gz	C0M005_DANRE Paired box 7b OS=Danio rerio OX=7955 GN=pax7b PE=2 SV=1
6	AFDB:F1Q9S0	0.492	0.501	1.678E-45	469	0.668	0.682	F1Q9S0.pdb.gz	F1Q9S0_DANRE Paired box 3b OS=Danio rerio OX=7955 GN=pax3b PE=3 SV=2
7	AFDB:P06601	0.271	0.213	9.243E-27	613	0.441	0.344	P06601.pdb.gz	PRD_DROME Segmentation protein paired OS=Drosophila melanogaster OX=7227 GN=prd PE=1 SV=1
8	AFDB:G5EDS1	0.297	0.312	2.309E-26	455	0.338	0.356	G5EDS1.pdb.gz	VAB3_CAEEL Paired box protein 6 homolog OS=Caenorhabditis elegans OX=6239 GN=vab-3 PE=1 SV=1
9	AFDB:A0A0R4IQL7	0.283	0.300	1.667E-23	450	0.328	0.349	A0A0R4IQL7.pdb.gz	A0A0R4IQL7_DANRE Paired box 6b OS=Danio rerio OX=7955 GN=Pax6.2 PE=3 SV=1
10	AFDB:P09084	0.273	0.292	4.126E-18	446	0.296	0.318	P09084.pdb.gz	PAX1_MOUSE Paired box protein Pax-1 OS=Mus musculus OX=10090 GN=Pax1 PE=1 SV=4
11	PDB:2hi3A	0.107	0.624	1.199E-1	73	0.046	0.301	2hi3A.pdb.gz
12	PDB:4egcA	0.104	0.092	2.673E-1	539	0.033	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:7cpuSN	0.084	0.228	6.678E-1	150	0.058	0.187	7cpuSN.pdb.gz	A male germ-cell-specific ribosome controls male fertility.
14	PDB:7pzyO	0.080	0.226	7.071E-1	150	0.056	0.180	7pzyO.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
15	PDB:4v6wAN	0.083	0.224	7.488E-1	150	0.056	0.180	4v6wAN.pdb.gz	Structures of the human and Drosophila 80S ribosome.
16	PDB:2cg4A	0.089	0.266	7.929E-1	149	0.031	0.101	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:7a1gY	0.076	0.221	7.929E-1	150	0.042	0.133	7a1gY.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
18	PDB:6lthO	0.091	0.127	9.414E-1	325	0.063	0.092	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
19	PDB:5gm6c	0.084	0.096	9.969E-1	415	0.069	0.080	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:6xywBD	0.076	0.162	9.969E-1	210	0.065	0.148	6xywBD.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IM38	0.0	726	487	0.760	0.747	A0A0R4IM38_DANRE Paired box 7 isoform PAX7D OS=Danio rerio OX=7955 GN=pax7a PE=3 SV=1
2	A5GZA7	0.0	726	502	0.762	0.727	A5GZA7_CHICK Pax7 variant OS=Gallus gallus OX=9031 PE=2 SV=1
3	C0M005	0.0	718	510	0.762	0.716	C0M005_DANRE Paired box 7b OS=Danio rerio OX=7955 GN=pax7b PE=2 SV=1
4	F1LMV3	0.0	967	484	0.977	0.967	F1LMV3_RAT Paired box 3 OS=Rattus norvegicus OX=10116 GN=Pax3 PE=3 SV=2
5	F1Q9S0	0.0	570	469	0.666	0.680	F1Q9S0_DANRE Paired box 3b OS=Danio rerio OX=7955 GN=pax3b PE=3 SV=2
6	O57416	0.0	702	509	0.777	0.731	O57416_DANRE Paired box 3a OS=Danio rerio OX=7955 GN=pax3 PE=2 SV=1
7	O57418	0.0	727	507	0.758	0.716	O57418_DANRE Paired box 7 isoform PAX7C OS=Danio rerio OX=7955 GN=pax7 PE=2 SV=1
8	P23759	0.0	727	505	0.768	0.729	PAX7_HUMAN Paired box protein Pax-7 OS=Homo sapiens OX=9606 GN=PAX7 PE=1 SV=4
9	P23760	0.0	990	479	1.000	1.000	PAX3_HUMAN Paired box protein Pax-3 OS=Homo sapiens OX=9606 GN=PAX3 PE=1 SV=2
10	P24610	0.0	979	479	0.987	0.987	PAX3_MOUSE Paired box protein Pax-3 OS=Mus musculus OX=10090 GN=Pax3 PE=1 SV=2
11	P47239	0.0	733	503	0.775	0.738	PAX7_MOUSE Paired box protein Pax-7 OS=Mus musculus OX=10090 GN=Pax7 PE=1 SV=2
12	Q0IH87	0.0	902	483	0.916	0.909	PAX3B_XENLA Paired box protein Pax-3-B OS=Xenopus laevis OX=8355 GN=pax3-b PE=2 SV=2
13	Q645N4	0.0	902	484	0.908	0.899	PAX3A_XENLA Paired box protein Pax-3-A OS=Xenopus laevis OX=8355 GN=pax3-a PE=2 SV=1
14	Q8QGS3	0.0	949	484	0.956	0.946	Q8QGS3_CHICK Paired box 3 OS=Gallus gallus OX=9031 GN=Pax3 PE=2 SV=1
15	Q9PSS2	9.79e-115	337	190	0.363	0.916	Q9PSS2_CHICK Paired box PAX-3 OS=Gallus gallus OX=9031 PE=3 SV=1
16	P06601	2.21e-108	336	613	0.344	0.269	PRD_DROME Segmentation protein paired OS=Drosophila melanogaster OX=7227 GN=prd PE=1 SV=1
17	P09082	4.52e-106	324	427	0.342	0.384	GSB_DROME Protein gooseberry OS=Drosophila melanogaster OX=7227 GN=gsb PE=2 SV=1
18	P09083	2.74e-105	323	449	0.349	0.372	GSBN_DROME Protein gooseberry-neuro OS=Drosophila melanogaster OX=7227 GN=gsb-n PE=1 SV=2
19	G5EDS1	4.02e-82	263	455	0.280	0.295	VAB3_CAEEL Paired box protein 6 homolog OS=Caenorhabditis elegans OX=6239 GN=vab-3 PE=1 SV=1
20	P63016	1.42e-81	261	422	0.280	0.318	PAX6_RAT Paired box protein Pax-6 OS=Rattus norvegicus OX=10116 GN=Pax6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19498 DUF6033	7.8e+02	11.4	Protein of unknown function (DUF6033)
2	PF05920 Homeobox_KN	0.38	22.0	Homeobox KN domain
3	PF00046 Homeodomain	3.6e-19	79.7	Homeodomain
4	PF13384 HTH_23	0.092	23.9	Homeodomain-like domain
5	PF13565 HTH_32	0.0072	28.2	Homeodomain-like domain
6	PF12759 HTH_Tnp_IS1	5.7e+02	11.6	InsA C-terminal domain
7	PF00292 PAX	2.7e-72	252.0	'Paired box' domain
8	PF12360 Pax7	2.3e-22	90.2	Paired box protein 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000004080

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000003130	0.861	Uncharacterized protein
2	60711.ENSCSAP00000017137	0.807	Paired box 7
3	60711.ENSCSAP00000003962	0.771	Transducin-like enhancer of split 4
4	60711.ENSCSAP00000013863	0.756	Forkhead box O1
5	60711.ENSCSAP00000010494	0.713	Cell surface proteoglycan
6	60711.ENSCSAP00000001252	0.695	Induces fibroblasts to differentiate into myoblasts. Acts as a transcriptional activator that promotes transcription of muscle- specific target genes and plays a role in muscle differentiation.
7	60711.ENSCSAP00000000253	0.685	annotation not available
8	60711.ENSCSAP00000004734	0.685	Nuclear receptor coactivator 1
9	60711.ENSCSAP00000010422	0.684	Myogenin (myogenic factor 4)
10	60711.ENSCSAP00000017842	0.666	Forkhead box D3
11	60711.ENSCSAP00000000256	0.656	Myogenic factor 6 (herculin)
12	60711.ENSCSAP00000000331	0.653	Lymphoid enhancer-binding factor 1
13	60711.ENSCSAP00000007551	0.622	Acts as a tumor suppressor in many tumor types
14	60711.ENSCSAP00000009815	0.622	Transducin-like enhancer of split 3
15	60711.ENSCSAP00000012943	0.614	Catenin beta 1
16	60711.ENSCSAP00000011584	0.602	ASH2 like histone lysine methyltransferase complex subunit
17	60711.ENSCSAP00000003952	0.596	Transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila)
18	60711.ENSCSAP00000007608	0.588	Zic family member 1
19	60711.ENSCSAP00000010313	0.572	SIX homeobox 1
20	60711.ENSCSAP00000000731	0.570	SRY-box 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	0.999	DNA-binding transcription factor activity
GO:1990837	0.997	sequence-specific double-stranded DNA binding
GO:0000981	0.967	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.949	transcription cis-regulatory region binding
GO:0019904	0.871	protein domain specific binding
GO:0000977	0.762	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.729	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.709	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.692	DNA-binding transcription activator activity
GO:0001228	0.603	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0071837	0.339	HMG box domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.997	multicellular organismal process
GO:0048856	0.997	anatomical structure development
GO:0007275	0.994	multicellular organism development
GO:0009987	0.993	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0009888	0.962	tissue development
GO:0048513	0.936	animal organ development
GO:0019222	0.927	regulation of metabolic process
GO:0048518	0.905	positive regulation of biological process
GO:0048522	0.896	positive regulation of cellular process
GO:0050896	0.892	response to stimulus
GO:0080090	0.890	regulation of primary metabolic process
GO:0051171	0.890	regulation of nitrogen compound metabolic process
GO:0031323	0.890	regulation of cellular metabolic process
GO:0030154	0.887	cell differentiation
GO:0009653	0.886	anatomical structure morphogenesis
GO:0010468	0.885	regulation of gene expression
GO:0048731	0.880	system development
GO:0006357	0.879	regulation of transcription by RNA polymerase II
GO:0010604	0.878	positive regulation of macromolecule metabolic process
GO:0031328	0.869	positive regulation of cellular biosynthetic process
GO:0045935	0.868	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.817	positive regulation of DNA-templated transcription
GO:0045944	0.775	positive regulation of transcription by RNA polymerase II
GO:0050793	0.762	regulation of developmental process
GO:0048519	0.761	negative regulation of biological process
GO:0048523	0.739	negative regulation of cellular process
GO:0045595	0.647	regulation of cell differentiation
GO:0051716	0.622	cellular response to stimulus
GO:0045165	0.544	cell fate commitment
GO:0042127	0.518	regulation of cell population proliferation
GO:0048863	0.503	stem cell differentiation
GO:0009790	0.483	embryo development
GO:0043009	0.471	chordate embryonic development
GO:0048468	0.452	cell development
GO:0009887	0.451	animal organ morphogenesis
GO:0007399	0.440	nervous system development
GO:0048646	0.434	anatomical structure formation involved in morphogenesis
GO:0007165	0.407	signal transduction
GO:0007166	0.395	cell surface receptor signaling pathway
GO:0051172	0.374	negative regulation of nitrogen compound metabolic process
GO:0031324	0.374	negative regulation of cellular metabolic process
GO:0010605	0.368	negative regulation of macromolecule metabolic process
GO:0045934	0.342	negative regulation of nucleobase-containing compound metabolic process
GO:0051239	0.338	regulation of multicellular organismal process
GO:0060429	0.330	epithelium development
GO:0010628	0.326	positive regulation of gene expression
GO:1903507	0.319	negative regulation of nucleic acid-templated transcription
GO:0060485	0.312	mesenchyme development
GO:0048699	0.305	generation of neurons

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.956	nucleoplasm
GO:0032991	0.950	protein-containing complex
GO:0005737	0.479	cytoplasm
GO:0043232	0.426	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]