StarFunc result for job id P23769

User Input

>input (480 residues)
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYY
ANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSP
FSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKE
VSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQP
ATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGA
TATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLW
RRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKC
MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O09100	0.448	0.448	7.549E-74	480	0.979	0.979	O09100.pdb.gz	GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus OX=10090 GN=Gata2 PE=1 SV=2
2	AFDB:P23824	0.398	0.408	4.257E-65	466	0.867	0.893	P23824.pdb.gz	GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus OX=9031 GN=GATA2 PE=2 SV=1
3	AFDB:Q6NW63	0.224	0.215	4.448E-22	501	0.317	0.303	Q6NW63.pdb.gz	Q6NW63_DANRE GATA-binding protein 6 OS=Danio rerio OX=7955 GN=GATA-5 PE=2 SV=2
4	AFDB:Q3S1J8	0.159	0.157	2.973E-21	488	0.275	0.270	Q3S1J8.pdb.gz	Q3S1J8_CAEEL GATA-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elt-1 PE=4 SV=1
5	AFDB:O94720	0.137	0.119	2.324E-15	557	0.250	0.215	O94720.pdb.gz	FIL1_SCHPO Transcription factor fil1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fil1 PE=2 SV=1
6	AFDB:Q5A432	0.118	0.084	4.118E-8	688	0.173	0.121	Q5A432.pdb.gz	GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GAT1 PE=2 SV=1
7	AFDB:Q6FWW9	0.123	0.076	3.165E-6	823	0.190	0.111	Q6FWW9.pdb.gz	Q6FWW9_CANGA Candida glabrata strain CBS138 chromosome C complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GLN3 PE=4 SV=1
8	AFDB:Q10280	0.120	0.069	4.444E-6	855	0.215	0.120	Q10280.pdb.gz	GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gaf1 PE=1 SV=2
9	AFDB:Q8N1W1	0.080	0.032	2.615E-3	1705	0.156	0.044	Q8N1W1.pdb.gz	ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens OX=9606 GN=ARHGEF28 PE=1 SV=3
10	AFDB:Q96T25	0.079	0.063	2.626E-2	663	0.194	0.140	Q96T25.pdb.gz	ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens OX=9606 GN=ZIC5 PE=1 SV=2
11	PDB:5dkaA	0.072	0.294	1.569E-1	96	0.035	0.177	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:4kfzB	0.071	0.199	5.320E-1	148	0.046	0.149	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
13	PDB:1b8tA	0.057	0.129	7.993E-1	192	0.054	0.135	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
14	PDB:7a1gM	0.074	0.540	1.049	53	0.017	0.151	7a1gM.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
15	PDB:1imlA	0.064	0.297	1.575	76	0.023	0.145	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
16	PDB:4r8pL	0.072	0.127	1.931	254	0.025	0.047	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
17	PDB:7pzye	0.068	0.479	1.931	55	0.015	0.127	7pzye.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
18	PDB:5a31B	0.065	0.303	2.533	84	0.023	0.131	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
19	PDB:1q3bA	0.041	0.067	2.711	259	0.015	0.027	1q3bA.pdb.gz	Structure of the uncomplexed DNA repair enzyme endonuclease VIII indicates significant interdomain flexibility.
20	PDB:3j6b3	0.058	0.121	2.711	126	0.037	0.143	3j6b3.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O09100	0.0	958	480	0.979	0.979	GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus OX=10090 GN=Gata2 PE=1 SV=2
2	P23769	0.0	976	480	1.000	1.000	GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens OX=9606 GN=GATA2 PE=1 SV=3
3	P23824	0.0	781	466	0.848	0.873	GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus OX=9031 GN=GATA2 PE=2 SV=1
4	P23825	0.0	517	444	0.621	0.671	GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus OX=9031 GN=GATA3 PE=2 SV=1
5	Q7T3G1	0.0	617	456	0.708	0.746	Q7T3G1_DANRE GATA-binding protein 2a OS=Danio rerio OX=7955 GN=gata2 PE=2 SV=1
6	Q924Y4	0.0	953	480	0.975	0.975	GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus OX=10116 GN=Gata2 PE=1 SV=1
7	P23771	4.11e-180	513	443	0.623	0.675	GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens OX=9606 GN=GATA3 PE=1 SV=1
8	P23772	1.79e-179	511	443	0.629	0.682	GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus OX=10090 GN=Gata3 PE=1 SV=1
9	Q91428	1.41e-176	504	438	0.625	0.685	GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio OX=7955 GN=gata3 PE=2 SV=1
10	F1QD30	3.08e-152	442	428	0.546	0.612	F1QD30_DANRE Endothelial transcription factor GATA-2 isoform X1 OS=Danio rerio OX=7955 GN=zgc:91840 PE=4 SV=1
11	Q6DG89	2.60e-151	439	427	0.542	0.609	Q6DG89_DANRE Endothelial transcription factor GATA-2 OS=Danio rerio OX=7955 GN=zgc:91840 PE=2 SV=1
12	A0A8I6A6L1	3.75e-142	416	423	0.560	0.636	A0A8I6A6L1_RAT GATA binding protein 3 OS=Rattus norvegicus OX=10116 GN=Gata3 PE=4 SV=1
13	Q90410	1.05e-89	281	418	0.427	0.490	Q90410_DANRE GATA binding protein 1a OS=Danio rerio OX=7955 GN=zg1 PE=2 SV=1
14	P91623	3.01e-70	233	486	0.304	0.300	GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster OX=7227 GN=grn PE=2 SV=1
15	P23767	6.43e-70	228	359	0.290	0.387	GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis OX=8355 GN=gata1-a PE=2 SV=1
16	P17678	7.26e-67	219	304	0.198	0.312	GATA1_CHICK Erythroid transcription factor OS=Gallus gallus OX=9031 GN=GATA1 PE=1 SV=1
17	Q91677	4.70e-66	219	392	0.229	0.281	GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis OX=8355 GN=gata4 PE=2 SV=1
18	P15976	1.02e-64	216	413	0.269	0.312	GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens OX=9606 GN=GATA1 PE=1 SV=1
19	I3LUZ9	5.21e-64	216	443	0.208	0.226	I3LUZ9_PIG GATA binding protein 4 OS=Sus scrofa OX=9823 GN=GATA4 PE=4 SV=2
20	P43429	7.30e-64	214	413	0.260	0.303	GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus OX=10116 GN=Gata1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00320 GATA	5.2e-26	101.3	GATA zinc finger
2	PF18694 TDP43_N	8.3e+02	11.3	Transactive response DNA-binding protein N-terminal domain
3	PF08271 TF_Zn_Ribbon	3.1	18.7	TFIIB zinc-binding
4	PF09723 Zn-ribbon_8	8.9e+02	11.5	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000017404

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017707	0.897	Spi-1 proto-oncogene
2	61853.ENSNLEP00000018227	0.895	LIM domain binding 1
3	61853.ENSNLEP00000019891	0.891	Uncharacterized protein
4	61853.ENSNLEP00000004775	0.880	Zinc finger protein, FOG family member 2
5	61853.ENSNLEP00000021762	0.876	LIM domain only 2 (rhombotin-like 1)
6	61853.ENSNLEP00000000534	0.830	NK2 homeobox 5
7	61853.ENSNLEP00000005245	0.829	Runt-related transcription factor
8	61853.ENSNLEP00000017965	0.821	Jun proto-oncogene, AP-1 transcription factor subunit
9	61853.ENSNLEP00000020105	0.772	LIM domain binding 2
10	61853.ENSNLEP00000000574	0.770	Zinc finger protein, FOG family member 1
11	61853.ENSNLEP00000008193	0.769	Transcription factor 12
12	61853.ENSNLEP00000023718	0.762	MYB proto-oncogene, transcription factor
13	61853.ENSNLEP00000014415	0.755	Mothers against decapentaplegic homolog
14	61853.ENSNLEP00000012741	0.750	Growth factor independent 1 transcription repressor
15	61853.ENSNLEP00000017749	0.746	NK2 homeobox 3
16	61853.ENSNLEP00000000665	0.736	Uncharacterized protein
17	61853.ENSNLEP00000013695	0.736	Ets variant 2
18	61853.ENSNLEP00000009100	0.728	Fli-1 proto-oncogene, ETS transcription factor
19	61853.ENSNLEP00000015368	0.724	Bone morphogenetic protein 4
20	61853.ENSNLEP00000019981	0.724	Fos proto-oncogene, AP-1 transcription factor subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0001221	0.997	transcription coregulator binding
GO:0000976	0.988	transcription cis-regulatory region binding
GO:0000977	0.904	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001223	0.903	transcription coactivator binding
GO:0000987	0.892	cis-regulatory region sequence-specific DNA binding
GO:0001216	0.869	DNA-binding transcription activator activity
GO:0000978	0.846	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003682	0.620	chromatin binding
GO:0001228	0.584	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0009889	0.993	regulation of biosynthetic process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048518	0.979	positive regulation of biological process
GO:0032502	0.978	developmental process
GO:0080090	0.978	regulation of primary metabolic process
GO:0010468	0.977	regulation of gene expression
GO:0031323	0.976	regulation of cellular metabolic process
GO:0048856	0.970	anatomical structure development
GO:0045944	0.966	positive regulation of transcription by RNA polymerase II
GO:0032501	0.963	multicellular organismal process
GO:0007275	0.914	multicellular organism development
GO:0050896	0.892	response to stimulus
GO:0048731	0.866	system development
GO:0048523	0.827	negative regulation of cellular process
GO:0030154	0.825	cell differentiation
GO:0048513	0.818	animal organ development
GO:0051239	0.815	regulation of multicellular organismal process
GO:0010605	0.701	negative regulation of macromolecule metabolic process
GO:0045892	0.665	negative regulation of DNA-templated transcription
GO:0050793	0.657	regulation of developmental process
GO:0045595	0.625	regulation of cell differentiation
GO:0008152	0.595	metabolic process
GO:0071704	0.520	organic substance metabolic process
GO:0048583	0.495	regulation of response to stimulus
GO:0007399	0.492	nervous system development
GO:0000122	0.425	negative regulation of transcription by RNA polymerase II
GO:0048468	0.421	cell development
GO:0009653	0.417	anatomical structure morphogenesis
GO:0042127	0.402	regulation of cell population proliferation
GO:0051716	0.393	cellular response to stimulus
GO:0051240	0.366	positive regulation of multicellular organismal process
GO:0043170	0.353	macromolecule metabolic process
GO:0044237	0.352	cellular metabolic process
GO:0051094	0.344	positive regulation of developmental process
GO:0051246	0.340	regulation of protein metabolic process
GO:0006807	0.334	nitrogen compound metabolic process
GO:0044238	0.331	primary metabolic process
GO:0023051	0.308	regulation of signaling
GO:0010646	0.308	regulation of cell communication
GO:0042221	0.307	response to chemical
GO:0072359	0.302	circulatory system development
GO:0002682	0.300	regulation of immune system process
GO:0048699	0.300	generation of neurons

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.791	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]