StarFunc result for job id P23771

User Input

>input (443 residues)
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV
PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL
IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG
IQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT
PMHPPSSLSFGPHHPSSMVTAMG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23825	0.395	0.395	4.457E-65	444	0.919	0.917	P23825.pdb.gz	GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus OX=9031 GN=GATA3 PE=2 SV=1
2	AFDB:Q5A432	0.108	0.072	9.949E-8	688	0.223	0.144	Q5A432.pdb.gz	GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GAT1 PE=2 SV=1
3	AFDB:P18494	0.123	0.080	1.606E-5	730	0.183	0.111	P18494.pdb.gz	GLN3_YEAST Nitrogen regulatory protein GLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLN3 PE=1 SV=2
4	AFDB:A0A1C7CYY7	0.082	0.069	3.916E-3	577	0.172	0.132	A0A1C7CYY7.pdb.gz	A0A1C7CYY7_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
5	AFDB:Q55C49	0.076	0.041	7.784E-3	1006	0.187	0.083	Q55C49.pdb.gz	GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum OX=44689 GN=gtaG PE=4 SV=1
6	AFDB:Q584L1	0.072	0.055	7.784E-3	669	0.165	0.109	Q584L1.pdb.gz	Q584L1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.250 PE=4 SV=1
7	AFDB:P97433	0.063	0.025	1.098E-2	1693	0.178	0.047	P97433.pdb.gz	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
8	AFDB:P31367	0.072	0.055	2.872E-2	610	0.126	0.092	P31367.pdb.gz	PO6F1_DANRE POU domain, class 6, transcription factor 1 OS=Danio rerio OX=7955 GN=pou6f1 PE=2 SV=1
9	AFDB:E9QAP7	0.063	0.032	6.115E-2	1042	0.187	0.080	E9QAP7.pdb.gz	E9QAP7_MOUSE TATA-box binding protein associated factor 4 OS=Mus musculus OX=10090 GN=Taf4 PE=1 SV=1
10	AFDB:A0A1D8PE20	0.072	0.041	1.135E-1	1073	0.158	0.065	A0A1D8PE20.pdb.gz	A0A1D8PE20_CANAL VASt domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C107440WA PE=3 SV=1
11	PDB:5dkaA	0.069	0.282	1.256E-1	96	0.036	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:4kfzB	0.074	0.197	2.865E-1	148	0.050	0.149	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
13	PDB:1b8tA	0.061	0.130	3.520E-1	192	0.059	0.135	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
14	PDB:7a1gM	0.079	0.523	4.039E-1	53	0.020	0.170	7a1gM.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
15	PDB:7pzye	0.078	0.505	5.316E-1	55	0.025	0.200	7pzye.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
16	PDB:7z17D	0.060	0.088	5.316E-1	279	0.018	0.029	7z17D.pdb.gz	Structural remodelling of the carbon-phosphorus lyase machinery by a dual ABC ATPase.
17	PDB:2pv0B	0.064	0.078	9.211E-1	347	0.038	0.049	2pv0B.pdb.gz	DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.
18	PDB:6gejS	0.070	0.135	1.132	208	0.045	0.096	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
19	PDB:3j6b3	0.057	0.110	1.391	126	0.032	0.111	3j6b3.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
20	PDB:2lgvA	0.069	0.263	1.490	100	0.018	0.080	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A6L1	0.0	742	423	0.887	0.929	A0A8I6A6L1_RAT GATA binding protein 3 OS=Rattus norvegicus OX=10116 GN=Gata3 PE=4 SV=1
2	P23771	0.0	902	443	1.000	1.000	GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens OX=9606 GN=GATA3 PE=1 SV=1
3	P23772	0.0	866	443	0.964	0.964	GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus OX=10090 GN=Gata3 PE=1 SV=1
4	P23825	0.0	799	444	0.923	0.921	GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus OX=9031 GN=GATA3 PE=2 SV=1
5	Q91428	0.0	644	438	0.795	0.804	GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio OX=7955 GN=gata3 PE=2 SV=1
6	P23824	5.18e-180	512	466	0.670	0.637	GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus OX=9031 GN=GATA2 PE=2 SV=1
7	Q924Y4	4.10e-176	503	480	0.679	0.627	GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus OX=10116 GN=Gata2 PE=1 SV=1
8	P23769	4.47e-174	498	480	0.673	0.621	GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens OX=9606 GN=GATA2 PE=1 SV=3
9	O09100	4.66e-172	493	480	0.670	0.619	GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus OX=10090 GN=Gata2 PE=1 SV=2
10	Q7T3G1	1.08e-155	450	456	0.623	0.605	Q7T3G1_DANRE GATA-binding protein 2a OS=Danio rerio OX=7955 GN=gata2 PE=2 SV=1
11	Q6DG89	2.70e-108	328	427	0.492	0.511	Q6DG89_DANRE Endothelial transcription factor GATA-2 OS=Danio rerio OX=7955 GN=zgc:91840 PE=2 SV=1
12	F1QD30	6.41e-108	327	428	0.492	0.509	F1QD30_DANRE Endothelial transcription factor GATA-2 isoform X1 OS=Danio rerio OX=7955 GN=zgc:91840 PE=4 SV=1
13	A0A2R8Y2A9	3.93e-99	294	143	0.323	1.000	A0A2R8Y2A9_HUMAN GATA binding protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=GATA3 PE=1 SV=1
14	Q90410	3.28e-82	261	418	0.427	0.452	Q90410_DANRE GATA binding protein 1a OS=Danio rerio OX=7955 GN=zg1 PE=2 SV=1
15	P91623	4.47e-72	237	486	0.345	0.315	GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster OX=7227 GN=grn PE=2 SV=1
16	P17678	1.72e-65	214	304	0.210	0.306	GATA1_CHICK Erythroid transcription factor OS=Gallus gallus OX=9031 GN=GATA1 PE=1 SV=1
17	P23767	9.52e-65	214	359	0.260	0.320	GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis OX=8355 GN=gata1-a PE=2 SV=1
18	Q91677	1.22e-63	212	392	0.217	0.245	GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis OX=8355 GN=gata4 PE=2 SV=1
19	P43694	2.73e-63	213	442	0.212	0.213	GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens OX=9606 GN=GATA4 PE=1 SV=2
20	I3LUZ9	3.04e-63	212	443	0.212	0.212	I3LUZ9_PIG GATA binding protein 4 OS=Sus scrofa OX=9823 GN=GATA4 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01412 ArfGap	3.4e+02	12.7	Putative GTPase activating protein for Arf
2	PF06677 Auto_anti-p27	2.2e+02	13.5	Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27)
3	PF09526 DUF2387	1.8e+02	13.6	Probable metal-binding protein (DUF2387)
4	PF18912 DZR_2	37	15.6	Double zinc ribbon domain
5	PF00320 GATA	5.5e-26	101.2	GATA zinc finger
6	PF08271 TF_Zn_Ribbon	0.06	24.2	TFIIB zinc-binding
7	PF09723 Zn-ribbon_8	29	16.2	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368632

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332973	0.996	Mothers against decapentaplegic homolog 3
2	9606.ENSP00000177694	0.988	T-box transcription factor TBX21
3	9606.ENSP00000250448	0.985	Hepatocyte nuclear factor 3-alpha
4	9606.ENSP00000294339	0.985	T-cell acute lymphocytic leukemia protein 1
5	9606.ENSP00000300134	0.981	Signal transducer and activator of transcription 6
6	9606.ENSP00000304915	0.981	Interleukin-13
7	9606.ENSP00000231454	0.980	Interleukin-5
8	9606.ENSP00000405330	0.976	Estrogen receptor
9	9606.ENSP00000365380	0.970	Forkhead box protein P3
10	9606.ENSP00000370842	0.967	Interleukin-33
11	9606.ENSP00000349508	0.962	Chromodomain-helicase-DNA-binding protein 4
12	9606.ENSP00000291527	0.956	Trefoil factor 1
13	9606.ENSP00000418960	0.952	Breast cancer type 1 susceptibility protein
14	9606.ENSP00000341551	0.947	Mothers against decapentaplegic homolog 4
15	9606.ENSP00000227507	0.946	G1/S-specific cyclin-D1
16	9606.ENSP00000229795	0.943	Mitogen-activated protein kinase 14
17	9606.ENSP00000382800	0.939	Runt-related transcription factor 3
18	9606.ENSP00000263253	0.938	Histone acetyltransferase p300
19	9606.ENSP00000392466	0.931	LIM domain-binding protein 1
20	9606.ENSP00000430690	0.929	Trefoil factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000976	0.998	transcription cis-regulatory region binding
GO:0008134	0.996	transcription factor binding
GO:0001223	0.977	transcription coactivator binding
GO:0003700	0.971	DNA-binding transcription factor activity
GO:0000981	0.882	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.680	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.630	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.536	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.411	DNA-binding transcription activator activity
GO:0001228	0.404	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.997	regulation of metabolic process
GO:0048518	0.992	positive regulation of biological process
GO:0050896	0.991	response to stimulus
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0010468	0.975	regulation of gene expression
GO:0009889	0.970	regulation of biosynthetic process
GO:0048522	0.970	positive regulation of cellular process
GO:0048856	0.967	anatomical structure development
GO:0009893	0.967	positive regulation of metabolic process
GO:0010604	0.964	positive regulation of macromolecule metabolic process
GO:0051171	0.961	regulation of nitrogen compound metabolic process
GO:0002376	0.959	immune system process
GO:0031326	0.959	regulation of cellular biosynthetic process
GO:0010556	0.957	regulation of macromolecule biosynthetic process
GO:0080090	0.956	regulation of primary metabolic process
GO:1903506	0.948	regulation of nucleic acid-templated transcription
GO:0006355	0.944	regulation of DNA-templated transcription
GO:0031325	0.942	positive regulation of cellular metabolic process
GO:0051173	0.941	positive regulation of nitrogen compound metabolic process
GO:0009891	0.922	positive regulation of biosynthetic process
GO:0045893	0.912	positive regulation of DNA-templated transcription
GO:0006357	0.904	regulation of transcription by RNA polymerase II
GO:0032501	0.892	multicellular organismal process
GO:0048519	0.847	negative regulation of biological process
GO:0048513	0.834	animal organ development
GO:0048523	0.791	negative regulation of cellular process
GO:0045944	0.783	positive regulation of transcription by RNA polymerase II
GO:0007275	0.716	multicellular organism development
GO:0051716	0.712	cellular response to stimulus
GO:0042221	0.703	response to chemical
GO:0010605	0.701	negative regulation of macromolecule metabolic process
GO:0030154	0.682	cell differentiation
GO:0048731	0.658	system development
GO:0051172	0.632	negative regulation of nitrogen compound metabolic process
GO:0031324	0.626	negative regulation of cellular metabolic process
GO:0045934	0.525	negative regulation of nucleobase-containing compound metabolic process
GO:0045892	0.520	negative regulation of DNA-templated transcription
GO:0007154	0.488	cell communication
GO:0023052	0.478	signaling
GO:0048583	0.470	regulation of response to stimulus
GO:0006950	0.468	response to stress
GO:0051239	0.464	regulation of multicellular organismal process
GO:0007165	0.430	signal transduction
GO:0010033	0.421	response to organic substance
GO:0030097	0.362	hemopoiesis
GO:0008152	0.341	metabolic process
GO:0042127	0.310	regulation of cell population proliferation
GO:0009653	0.304	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.978	nuclear lumen
GO:0005654	0.972	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]