StarFunc result for job id P23786

User Input

>input (658 residues)
MVPRLLLRAWPRGPAVGPGAPSRPLSAGSGPGQYLQRSIVPTMHYQDSLPRLPIPKLEDT
IRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYISGPWFDMY
LSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNP
AKSDTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKA
RHLLVLRKGNFYIFDVLDQDGNIVSPSEIQAHLKYILSDSSPAPEFPLAYLTSENRDIWA
ELRQKLMSSGNEESLRKVDSAVFCLCLDDFPIKDLVHLSHNMLHGDGTNRWFDKSFNLII
AKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELT
DALKTGITAAKEKFDATMKTLTIDCVQFQRGGKEFLKKQKLSPDAVAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASVYTKRCSEAFVREPSRHSAGELQQMMVECSKYHG
QLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLG
GFAPVVSDGFGVGYAVHDNWIGCNVSSYPGRNAREFLQCVEKALEDMFDALEGKSIKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1B0GVF3	0.974	0.957	0.000	670	0.997	0.979	A0A1B0GVF3.pdb.gz	A0A1B0GVF3_HUMAN Carnitine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=CPT2 PE=1 SV=1
2	AFDB:A0A1B0GWC0	0.949	0.965	0.000	647	0.967	0.983	A0A1B0GWC0.pdb.gz	A0A1B0GWC0_HUMAN Carnitine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=CPT2 PE=1 SV=1
3	AFDB:P18886	0.956	0.956	6.776E-104	658	0.834	0.834	P18886.pdb.gz	CPT2_RAT Carnitine O-palmitoyltransferase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cpt2 PE=1 SV=1
4	PDB:4eywB	0.952	0.987	3.946E-99	634	0.805	0.836	4eywB.pdb.gz	Isothermal titration calorimetry with micelles: Thermodynamics of inhibitor binding to carnitine palmitoyltransferase 2 membrane protein.
5	AFDB:Q8MQY1	0.927	0.877	4.334E-72	696	0.441	0.417	Q8MQY1.pdb.gz	Q8MQY1_DROME SD01848p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CPT2 PE=2 SV=1
6	AFDB:Q5BEH1	0.821	0.675	3.494E-50	804	0.327	0.267	Q5BEH1.pdb.gz	Q5BEH1_EMENI Choline/carnitine acyltransferase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN1059.2 PE=3 SV=1
7	AFDB:C8V1G3	0.838	0.856	1.793E-49	644	0.290	0.297	C8V1G3.pdb.gz	C8V1G3_EMENI Choline/carnitine acyltransferase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06279 PE=3 SV=1
8	AFDB:P43155	0.826	0.867	3.961E-49	626	0.277	0.291	P43155.pdb.gz	CACP_HUMAN Carnitine O-acetyltransferase OS=Homo sapiens OX=9606 GN=CRAT PE=1 SV=5
9	PDB:2h3pA	0.822	0.901	1.541E-48	599	0.278	0.306	2h3pA.pdb.gz	Crystal structures of murine carnitine acetyltransferase in ternary complexes with its substrates
10	AFDB:P11466	0.808	0.867	9.921E-48	612	0.267	0.288	P11466.pdb.gz	OCTC_RAT Peroxisomal carnitine O-octanoyltransferase OS=Rattus norvegicus OX=10116 GN=Crot PE=1 SV=3
11	AFDB:Q59T80	0.814	0.676	1.095E-47	795	0.307	0.254	Q59T80.pdb.gz	Q59T80_CANAL Carnitine O-acetyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CTN1 PE=3 SV=1
12	AFDB:B2ZGJ1	0.802	0.828	1.985E-47	637	0.264	0.273	B2ZGJ1.pdb.gz	CLAT_DANRE Choline O-acetyltransferase OS=Danio rerio OX=7955 GN=chat PE=2 SV=1
13	PDB:1q6xA	0.809	0.884	1.092E-46	600	0.272	0.298	1q6xA.pdb.gz
14	PDB:1xl8B	0.806	0.881	9.664E-46	600	0.275	0.302	1xl8B.pdb.gz	Crystal structure of mouse carnitine octanoyltransferase and molecular determinants of substrate selectivity.
15	PDB:6wcsA	0.288	0.392	1.002E-4	438	0.084	0.126	6wcsA.pdb.gz
16	PDB:6mk2A	0.250	0.368	1.564E-4	407	0.078	0.125	6mk2A.pdb.gz	Independent evolution of rosmarinic acid biosynthesis in two sister families under the Lamiids clade of flowering plants.
17	PDB:1q9jB	0.234	0.359	1.727E-4	399	0.053	0.088	1q9jB.pdb.gz
18	PDB:1l5aA	0.223	0.304	2.213E-4	424	0.071	0.111	1l5aA.pdb.gz
19	PDB:7cysA	0.288	0.400	2.325E-4	431	0.087	0.132	7cysA.pdb.gz
20	PDB:2xr7A	0.208	0.279	2.443E-4	452	0.056	0.082	2xr7A.pdb.gz	Structural Basis for Modification of Flavonol and Naphthol Glucoconjugates by Nicotiana Tabacum Malonyltransferase (Ntmat1).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VK13	0.0	1373	658	1.000	1.000	A0A140VK13_HUMAN Testicular secretory protein Li 13 OS=Homo sapiens OX=9606 PE=2 SV=1
2	A0A1B0GTB8	0.0	1311	635	0.965	1.000	A0A1B0GTB8_HUMAN Carnitine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=CPT2 PE=1 SV=1
3	A0A1B0GV75	0.0	1145	598	0.834	0.918	A0A1B0GV75_HUMAN Carnitine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=CPT2 PE=1 SV=1
4	A0A1B0GVF3	0.0	1364	670	1.000	0.982	A0A1B0GVF3_HUMAN Carnitine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=CPT2 PE=1 SV=1
5	A0A1B0GWC0	0.0	1311	647	0.967	0.983	A0A1B0GWC0_HUMAN Carnitine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=CPT2 PE=1 SV=1
6	P18886	0.0	1192	658	0.836	0.836	CPT2_RAT Carnitine O-palmitoyltransferase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cpt2 PE=1 SV=1
7	P23786	0.0	1373	658	1.000	1.000	CPT2_HUMAN Carnitine O-palmitoyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=CPT2 PE=1 SV=2
8	P52825	0.0	1231	658	0.872	0.872	CPT2_MOUSE Carnitine O-palmitoyltransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Cpt2 PE=1 SV=2
9	Q8MQY1	0.0	591	696	0.448	0.424	Q8MQY1_DROME SD01848p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CPT2 PE=2 SV=1
10	Q9VZW7	0.0	590	667	0.447	0.441	Q9VZW7_DROME Carnitine palmitoyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=CPT2 PE=1 SV=1
11	Q5BEH1	1.47e-92	305	804	0.334	0.274	Q5BEH1_EMENI Choline/carnitine acyltransferase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN1059.2 PE=3 SV=1
12	P47934	3.65e-82	273	626	0.295	0.310	CACP_MOUSE Carnitine O-acetyltransferase OS=Mus musculus OX=10090 GN=Crat PE=1 SV=3
13	P43155	2.11e-81	271	626	0.293	0.308	CACP_HUMAN Carnitine O-acetyltransferase OS=Homo sapiens OX=9606 GN=CRAT PE=1 SV=5
14	Q704S8	7.84e-81	270	626	0.296	0.312	CACP_RAT Carnitine O-acetyltransferase OS=Rattus norvegicus OX=10116 GN=Crat PE=1 SV=1
15	P80235	9.46e-79	266	687	0.309	0.295	CACM_YEAST Putative mitochondrial carnitine O-acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAT1 PE=1 SV=2
16	C8V1G3	1.53e-77	261	644	0.281	0.287	C8V1G3_EMENI Choline/carnitine acyltransferase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06279 PE=3 SV=1
17	Q59T80	4.91e-77	264	795	0.284	0.235	Q59T80_CANAL Carnitine O-acetyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CTN1 PE=3 SV=1
18	Q03059	6.45e-76	257	641	0.290	0.298	CLAT_MOUSE Choline O-acetyltransferase OS=Mus musculus OX=10090 GN=Chat PE=2 SV=2
19	Q7JQH9	4.67e-75	258	780	0.310	0.262	Q7JQH9_DROME carnitine O-palmitoyltransferase OS=Drosophila melanogaster OX=7227 GN=whd PE=1 SV=1
20	Q9DC50	4.20e-74	251	612	0.284	0.306	OCTC_MOUSE Peroxisomal carnitine O-octanoyltransferase OS=Mus musculus OX=10090 GN=Crot PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00755 Carn_acyltransf	5.7e-186	631.1	Choline/Carnitine o-acyltransferase
2	PF07428 Tri3	2.9e+02	11.5	15-O-acetyltransferase Tri3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360541

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326305	0.997	Mitochondrial carnitine/acylcarnitine carrier protein
2	9606.ENSP00000438689	0.987	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
3	9606.ENSP00000233710	0.983	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
4	9606.ENSP00000293217	0.982	Peroxisomal acyl-coenzyme A oxidase 1
5	9606.ENSP00000385523	0.971	Peroxisome proliferator-activated receptor alpha
6	9606.ENSP00000348775	0.958	Peroxisomal acyl-coenzyme A oxidase 3
7	9606.ENSP00000265641	0.937	Carnitine O-palmitoyltransferase 1, liver isoform
8	9606.ENSP00000376303	0.936	Carnitine O-palmitoyltransferase 1, brain isoform
9	9606.ENSP00000379011	0.934	Carnitine O-palmitoyltransferase 1, muscle isoform
10	9606.ENSP00000419692	0.913	Retinoic acid receptor RXR-alpha
11	9606.ENSP00000457466	0.909	Chromodomain-helicase-DNA-binding protein 9
12	9606.ENSP00000217964	0.906	F-box-like/WD repeat-containing protein TBL1X
13	9606.ENSP00000262188	0.905	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
14	9606.ENSP00000262367	0.903	CREB-binding protein
15	9606.ENSP00000405574	0.901	F-box-like/WD repeat-containing protein TBL1XR1
16	9606.ENSP00000260129	0.900	Trimethylguanosine synthase
17	9606.ENSP00000300651	0.900	Mediator of RNA polymerase II transcription subunit 1
18	9606.ENSP00000325690	0.900	Histone-arginine methyltransferase CARM1
19	9606.ENSP00000363929	0.900	Nuclear receptor coactivator 6
20	9606.ENSP00000385216	0.900	Nuclear receptor coactivator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016409	1.000	palmitoyltransferase activity
GO:0016406	1.000	carnitine O-acyltransferase activity
GO:0005488	0.967	binding
GO:0005515	0.941	protein binding
GO:0004095	0.829	carnitine O-palmitoyltransferase activity
GO:0016407	0.550	acetyltransferase activity
GO:0016413	0.542	O-acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044255	0.995	cellular lipid metabolic process
GO:0032787	0.995	monocarboxylic acid metabolic process
GO:0046395	0.994	carboxylic acid catabolic process
GO:0010876	0.989	lipid localization
GO:0015718	0.987	monocarboxylic acid transport
GO:0006631	0.987	fatty acid metabolic process
GO:0030258	0.985	lipid modification
GO:0044242	0.985	cellular lipid catabolic process
GO:0006635	0.983	fatty acid beta-oxidation
GO:0015909	0.978	long-chain fatty acid transport
GO:1905039	0.743	carboxylic acid transmembrane transport
GO:0006807	0.689	nitrogen compound metabolic process
GO:1901564	0.643	organonitrogen compound metabolic process
GO:0050789	0.498	regulation of biological process
GO:0034641	0.440	cellular nitrogen compound metabolic process
GO:0006575	0.401	cellular modified amino acid metabolic process
GO:0006577	0.393	amino-acid betaine metabolic process
GO:0009058	0.370	biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0005654	0.989	nucleoplasm
GO:0043232	0.974	intracellular non-membrane-bounded organelle
GO:0016020	0.883	membrane
GO:0005730	0.729	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:12661	0.829	(R)-carnitine + hexadecanoyl-CoA = CoA + O-hexadecanoyl-(R)-carnitine
EC:2.3.1.21	0.829	carnitine O-palmitoyltransferase.

[back to server]