StarFunc result for job id P23919

User Input

>input (212 residues)
MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKK
SDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQP
DVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDA
SKSIEAVHEDIRVLSEDAIRTATEKPLGELWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23919	1.000	1.000	2.361E-44	212	1.000	1.000	P23919.pdb.gz	KTHY_HUMAN Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK PE=1 SV=4
2	PDB:1e2fA	0.987	0.997	7.541E-41	210	0.986	0.995	1e2fA.pdb.gz	Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate
3	AFDB:P97930	0.988	0.988	7.675E-38	212	0.811	0.811	P97930.pdb.gz	KTHY_MOUSE Thymidylate kinase OS=Mus musculus OX=10090 GN=Dtymk PE=1 SV=2
4	AFDB:D3ZUJ5	0.989	0.989	1.320E-37	212	0.811	0.811	D3ZUJ5.pdb.gz	D3ZUJ5_RAT dTMP kinase OS=Rattus norvegicus OX=10116 GN=Dtymk PE=3 SV=2
5	AFDB:F4KJ62	0.944	0.742	7.505E-28	271	0.486	0.380	F4KJ62.pdb.gz	F4KJ62_ARATH dTMP kinase OS=Arabidopsis thaliana OX=3702 GN=ZEU1 PE=1 SV=1
6	AFDB:P36590	0.892	0.900	3.287E-25	210	0.443	0.448	P36590.pdb.gz	KTHY_SCHPO Thymidylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tmp1 PE=1 SV=2
7	PDB:2wwfC	0.876	0.876	8.489E-24	212	0.377	0.377	2wwfC.pdb.gz	Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
8	AFDB:Q8I4S1	0.923	0.932	9.578E-24	210	0.387	0.390	Q8I4S1.pdb.gz	KTHY_PLAF7 Thymidylate kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=TMK PE=1 SV=1
9	AFDB:P00572	0.885	0.870	2.713E-20	216	0.434	0.426	P00572.pdb.gz	KTHY_YEAST Thymidylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC8 PE=1 SV=2
10	PDB:3tmkA	0.812	0.798	2.101E-19	216	0.406	0.398	3tmkA.pdb.gz	Crystal structure of yeast thymidylate kinase complexed with the bisubstrate inhibitor P1-(5'-adenosyl) P5-(5'-thymidyl) pentaphosphate (TP5A) at 2.0 A resolution: implications for catalysis and AZT activation.
11	AFDB:Q97R91	0.775	0.775	2.049E-13	212	0.217	0.217	Q97R91.pdb.gz	KTHY_STRPN Thymidylate kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=tmk PE=1 SV=1
12	AFDB:B0K028	0.444	0.751	2.454E-13	124	0.377	0.645	B0K028.pdb.gz	B0K028_RAT Deoxythymidylate kinase OS=Rattus norvegicus OX=10116 GN=Dtymk PE=1 SV=1
13	AFDB:Q57YW2	0.783	0.494	2.769E-13	345	0.283	0.174	Q57YW2.pdb.gz	Q57YW2_TRYB2 dTMP kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.680 PE=3 SV=1
14	PDB:4tmkA	0.766	0.773	1.685E-12	210	0.264	0.267	4tmkA.pdb.gz	Structural basis for efficient phosphorylation of 3'-azidothymidine monophosphate by Escherichia coli thymidylate kinase.
15	PDB:5nq5A	0.648	0.713	2.213E-10	191	0.236	0.262	5nq5A.pdb.gz	Structure Guided Lead Generation toward Nonchiral M. tuberculosis Thymidylate Kinase Inhibitors.
16	PDB:5nrnB	0.727	0.730	2.213E-10	211	0.241	0.242	5nrnB.pdb.gz	Mtb TMK crystal structure in complex with compound LS3080
17	PDB:2c95A	0.541	0.579	2.540E-7	195	0.165	0.179	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
18	PDB:1ukyA	0.528	0.562	7.510E-7	196	0.146	0.158	1ukyA.pdb.gz	Substrate specificity and assembly of the catalytic center derived from two structures of ligated uridylate kinase.
19	PDB:1tevA	0.473	0.506	8.471E-7	194	0.175	0.191	1tevA.pdb.gz
20	PDB:7ak5O	0.595	0.421	8.997E-7	320	0.212	0.141	7ak5O.pdb.gz	Structural basis for a complex I mutation that blocks pathological ROS production.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23919	1.77e-157	436	212	1.000	1.000	KTHY_HUMAN Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK PE=1 SV=4
2	P97930	3.72e-121	343	212	0.811	0.811	KTHY_MOUSE Thymidylate kinase OS=Mus musculus OX=10090 GN=Dtymk PE=1 SV=2
3	A0A8I6AFQ3	4.62e-91	268	228	0.642	0.596	A0A8I6AFQ3_RAT dTMP kinase OS=Rattus norvegicus OX=10116 GN=Dtymk PE=1 SV=1
4	Q0WW55	7.95e-69	213	263	0.491	0.395	ZEUS1_ARATH Thymidylate kinase OS=Arabidopsis thaliana OX=3702 GN=ZEU1 PE=2 SV=1
5	F4KJ62	9.02e-69	213	271	0.491	0.384	F4KJ62_ARATH dTMP kinase OS=Arabidopsis thaliana OX=3702 GN=ZEU1 PE=1 SV=1
6	D3ZUJ5	3.43e-65	200	153	0.486	0.673	D3ZUJ5_RAT dTMP kinase OS=Rattus norvegicus OX=10116 GN=Dtymk PE=3 SV=2
7	P36590	6.87e-62	193	210	0.443	0.448	KTHY_SCHPO Thymidylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tmp1 PE=1 SV=2
8	B0K028	1.71e-52	166	124	0.387	0.661	B0K028_RAT Deoxythymidylate kinase OS=Rattus norvegicus OX=10116 GN=Dtymk PE=1 SV=1
9	P00572	3.39e-49	161	216	0.401	0.394	KTHY_YEAST Thymidylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC8 PE=1 SV=2
10	Q8I4S1	3.77e-49	161	210	0.363	0.367	KTHY_PLAF7 Thymidylate kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=TMK PE=1 SV=1
11	Q57YW2	5.05e-10	60.1	345	0.283	0.174	Q57YW2_TRYB2 dTMP kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.680 PE=3 SV=1
12	P0A720	3.69e-08	53.9	213	0.264	0.263	KTHY_ECOLI Thymidylate kinase OS=Escherichia coli (strain K12) OX=83333 GN=tmk PE=1 SV=1
13	P9WKE1	5.27e-07	50.4	214	0.226	0.224	KTHY_MYCTU Thymidylate kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tmk PE=1 SV=1
14	Q97R91	2.84e-04	42.7	212	0.250	0.250	KTHY_STRPN Thymidylate kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=tmk PE=1 SV=1
15	O26009	0.16	34.3	191	0.151	0.168	KTHY_HELPY Thymidylate kinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=tmk PE=1 SV=1
16	Q57WB9	3.1	30.8	378	0.066	0.037	Q57WB9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.630 PE=4 SV=1
17	P70424	3.8	30.8	1256	0.071	0.012	ERBB2_MOUSE Receptor tyrosine-protein kinase erbB-2 OS=Mus musculus OX=10090 GN=Erbb2 PE=1 SV=3
18	P55852	6.3	28.9	100	0.071	0.150	SUMO1_ARATH Small ubiquitin-related modifier 1 OS=Arabidopsis thaliana OX=3702 GN=SUMO1 PE=1 SV=2
19	Q9DDV9	6.5	30.4	1684	0.085	0.011	Q9DDV9_ONCMY Complement component C3-4 (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
20	P32125	6.6	29.6	175	0.061	0.074	MOBB_ECOLI Molybdopterin-guanine dinucleotide biosynthesis adapter protein OS=Escherichia coli (strain K12) OX=83333 GN=mobB PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13671 AAA_33	15	17.2	AAA domain
2	PF02223 Thymidylate_kin	1.2e-50	183.3	Thymidylate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304802

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315644	0.992	Thymidylate synthase
2	9606.ENSP00000370376	0.991	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
3	9606.ENSP00000301634	0.988	Thymidine kinase, cytosolic
4	9606.ENSP00000349576	0.974	Deoxycytidylate deaminase
5	9606.ENSP00000300738	0.962	Ribonucleoside-diphosphate reductase large subunit
6	9606.ENSP00000219479	0.961	Nucleoside diphosphate kinase, mitochondrial
7	9606.ENSP00000360561	0.960	Ectonucleoside triphosphate diphosphohydrolase 8
8	9606.ENSP00000353770	0.956	Ribonucleoside-diphosphate reductase subunit M2
9	9606.ENSP00000376886	0.955	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC . Acts as a transcriptional activator of the MYC gene
10	9606.ENSP00000337060	0.954	Nucleoside diphosphate kinase A
11	9606.ENSP00000376889	0.954	Nucleoside diphosphate kinase
12	9606.ENSP00000299697	0.951	Thymidine kinase 2, mitochondrial
13	9606.ENSP00000373674	0.947	5'(3')-deoxyribonucleotidase, mitochondrial
14	9606.ENSP00000410186	0.947	Adenylate kinase 9
15	9606.ENSP00000416658	0.943	Nucleoside diphosphate kinase 6
16	9606.ENSP00000251810	0.942	Ribonucleoside-diphosphate reductase subunit M2 B
17	9606.ENSP00000219302	0.937	Nucleoside diphosphate kinase 3
18	9606.ENSP00000245552	0.935	5'(3')-deoxyribonucleotidase, cytosolic type
19	9606.ENSP00000265191	0.933	Nucleoside diphosphate kinase homolog 5
20	9606.ENSP00000356785	0.933	Nucleoside diphosphate kinase 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004798	1.000	thymidylate kinase activity
GO:0005488	0.999	binding
GO:0097159	0.953	organic cyclic compound binding
GO:1901363	0.952	heterocyclic compound binding
GO:0005515	0.948	protein binding
GO:1901265	0.875	nucleoside phosphate binding
GO:0043167	0.767	ion binding
GO:0036094	0.761	small molecule binding
GO:0000166	0.746	nucleotide binding
GO:0005524	0.725	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901137	0.996	carbohydrate derivative biosynthetic process
GO:0009262	0.995	deoxyribonucleotide metabolic process
GO:0006221	0.995	pyrimidine nucleotide biosynthetic process
GO:0009265	0.991	2'-deoxyribonucleotide biosynthetic process
GO:0009219	0.990	pyrimidine deoxyribonucleotide metabolic process
GO:0009132	0.986	nucleoside diphosphate metabolic process
GO:0050896	0.442	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0070013	0.968	intracellular organelle lumen
GO:0043231	0.961	intracellular membrane-bounded organelle
GO:0005634	0.862	nucleus
GO:0005739	0.696	mitochondrion
GO:0031981	0.307	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13517	1.000	ATP + dTMP = ADP + dTDP
EC:2.7.4.9	1.000	dTMP kinase.

[back to server]