StarFunc result for job id P23921

User Input

>input (792 residues)
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKST
LDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHK
EDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIY
LEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLD
EVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL
GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKI
IDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGAL
EASCDLAKEQGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIA
PMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQII
ACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCS
LENRDECLMCGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6auiA	0.926	0.984	0.000	745	0.938	0.997	6auiA.pdb.gz	3.3- angstrom resolution cryo-EM structure of human ribonucleotide reductase with substrate and allosteric regulators bound.
2	AFDB:P07742	0.992	0.992	0.000	792	0.976	0.976	P07742.pdb.gz	RIR1_MOUSE Ribonucleoside-diphosphate reductase large subunit OS=Mus musculus OX=10090 GN=Rrm1 PE=1 SV=2
3	AFDB:P21524	0.942	0.840	0.000	888	0.639	0.570	P21524.pdb.gz	RIR1_YEAST Ribonucleoside-diphosphate reductase large chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RNR1 PE=1 SV=2
4	AFDB:P21672	0.944	0.861	0.000	869	0.638	0.581	P21672.pdb.gz	RIR3_YEAST Ribonucleoside-diphosphate reductase large chain 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RNR3 PE=1 SV=4
5	AFDB:P36602	0.960	0.937	0.000	811	0.697	0.681	P36602.pdb.gz	RIR1_SCHPO Ribonucleoside-diphosphate reductase large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc22 PE=1 SV=2
6	AFDB:P48591	0.952	0.929	0.000	812	0.753	0.734	P48591.pdb.gz	RIR1_DROME Ribonucleoside-diphosphate reductase large subunit OS=Drosophila melanogaster OX=7227 GN=RnrL PE=1 SV=2
7	AFDB:Q54Q71	0.947	0.863	0.000	870	0.638	0.580	Q54Q71.pdb.gz	RIR1_DICDI Ribonucleoside-diphosphate reductase large subunit OS=Dictyostelium discoideum OX=44689 GN=rnrA PE=3 SV=1
8	AFDB:Q5A0N3	0.946	0.878	0.000	854	0.679	0.630	Q5A0N3.pdb.gz	Q5A0N3_CANAL Ribonucleoside-diphosphate reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RNR1 PE=3 SV=1
9	AFDB:Q9SJ20	0.938	0.910	0.000	816	0.688	0.668	Q9SJ20.pdb.gz	RIR1_ARATH Ribonucleoside-diphosphate reductase large subunit OS=Arabidopsis thaliana OX=3702 GN=RNR1 PE=1 SV=1
10	AFDB:O15909	0.946	0.894	7.486E-101	838	0.577	0.545	O15909.pdb.gz	RIR1_TRYBB Ribonucleoside-diphosphate reductase large subunit OS=Trypanosoma brucei brucei OX=5702 GN=RNR1 PE=1 SV=1
11	PDB:1zyzA	0.910	0.929	9.289E-94	776	0.622	0.635	1zyzA.pdb.gz
12	PDB:3rsrA	0.763	0.990	1.647E-78	610	0.514	0.667	3rsrA.pdb.gz	Evaluating the therapeutic potential of a non-natural nucleotide that inhibits human ribonucleotide reductase.
13	PDB:2cvtA	0.789	0.979	6.898E-74	637	0.543	0.675	2cvtA.pdb.gz	Structures of eukaryotic ribonucleotide reductase I provide insights into dNTP regulation
14	AFDB:Q9I4I1	0.893	0.738	3.188E-73	963	0.404	0.332	Q9I4I1.pdb.gz	Q9I4I1_PSEAE Ribonucleoside-diphosphate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nrdA PE=1 SV=1
15	PDB:5im3A	0.861	0.782	1.634E-69	874	0.394	0.357	5im3A.pdb.gz	Structural Mechanism of Allosteric Activity Regulation in a Ribonucleotide Reductase with Double ATP Cones.
16	PDB:5r1rA	0.830	0.888	1.861E-49	738	0.264	0.283	5r1rA.pdb.gz	A new mechanism-based radical intermediate in a mutant R1 protein affecting the catalytically essential Glu441 in Escherichia coli ribonucleotide reductase.
17	PDB:6mveA	0.706	0.817	1.398E-36	680	0.202	0.235	6mveA.pdb.gz	Convergent allostery in ribonucleotide reductase.
18	PDB:7rw6A	0.651	0.795	1.082E-33	642	0.194	0.240	7rw6A.pdb.gz	Cryo-EM structure of the EBV ribonucleotide reductase BORF2 and mechanism of APOBEC3B inhibition.
19	PDB:3oyzA	0.135	0.252	1.555E-2	376	0.068	0.144	3oyzA.pdb.gz	Crystal structures of a halophilic archaeal malate synthase from Haloferax volcanii and comparisons with isoforms A and G.
20	PDB:3jc54	0.080	0.101	1.258E-1	569	0.053	0.074	3jc54.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y915	0.0	1537	796	0.965	0.960	A0A8I5Y915_RAT Ribonucleoside-diphosphate reductase OS=Rattus norvegicus OX=10116 GN=Rrm1 PE=1 SV=1
2	E9PL69	0.0	1196	570	0.720	1.000	E9PL69_HUMAN Ribonucleotide reductase catalytic subunit M1 OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1
3	O15909	0.0	956	838	0.582	0.550	RIR1_TRYBB Ribonucleoside-diphosphate reductase large subunit OS=Trypanosoma brucei brucei OX=5702 GN=RNR1 PE=1 SV=1
4	P07742	0.0	1622	792	0.976	0.976	RIR1_MOUSE Ribonucleoside-diphosphate reductase large subunit OS=Mus musculus OX=10090 GN=Rrm1 PE=1 SV=2
5	P21524	0.0	1118	888	0.646	0.577	RIR1_YEAST Ribonucleoside-diphosphate reductase large chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RNR1 PE=1 SV=2
6	P21672	0.0	1124	869	0.640	0.583	RIR3_YEAST Ribonucleoside-diphosphate reductase large chain 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RNR3 PE=1 SV=4
7	P23921	0.0	1660	792	1.000	1.000	RIR1_HUMAN Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1
8	P36602	0.0	1190	811	0.708	0.692	RIR1_SCHPO Ribonucleoside-diphosphate reductase large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc22 PE=1 SV=2
9	P48591	0.0	1285	812	0.754	0.735	RIR1_DROME Ribonucleoside-diphosphate reductase large subunit OS=Drosophila melanogaster OX=7227 GN=RnrL PE=1 SV=2
10	Q54Q71	0.0	1068	870	0.641	0.584	RIR1_DICDI Ribonucleoside-diphosphate reductase large subunit OS=Dictyostelium discoideum OX=44689 GN=rnrA PE=3 SV=1
11	Q5A0N3	0.0	1172	854	0.692	0.642	Q5A0N3_CANAL Ribonucleoside-diphosphate reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RNR1 PE=3 SV=1
12	Q5U2Q5	0.0	1620	792	0.975	0.975	Q5U2Q5_RAT Ribonucleoside-diphosphate reductase OS=Rattus norvegicus OX=10116 GN=Rrm1 PE=3 SV=1
13	Q9I4I1	0.0	570	963	0.403	0.331	Q9I4I1_PSEAE Ribonucleoside-diphosphate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nrdA PE=1 SV=1
14	Q9SJ20	0.0	1170	816	0.694	0.674	RIR1_ARATH Ribonucleoside-diphosphate reductase large subunit OS=Arabidopsis thaliana OX=3702 GN=RNR1 PE=1 SV=1
15	P89462	7.42e-82	286	1142	0.258	0.179	RIR1_HHV2H Ribonucleoside-diphosphate reductase large subunit OS=Human herpesvirus 2 (strain HG52) OX=10315 GN=RIR1 PE=1 SV=1
16	U5TQE9	2.15e-81	285	1137	0.255	0.178	U5TQE9_HHV1 Ribonucleoside-diphosphate reductase large subunit OS=Human herpesvirus 1 OX=10298 GN=UL39 PE=1 SV=1
17	P08543	4.14e-81	284	1137	0.254	0.177	RIR1_HHV11 Ribonucleoside-diphosphate reductase large subunit OS=Human herpesvirus 1 (strain 17) OX=10299 GN=RIR1 PE=1 SV=2
18	P00452	3.74e-71	250	761	0.273	0.284	RIR1_ECOLI Ribonucleoside-diphosphate reductase 1 subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=nrdA PE=1 SV=2
19	Q0ILH2	1.51e-70	248	754	0.277	0.290	Q0ILH2_BPT6 Ribonucleoside-diphosphate reductase OS=Enterobacteria phage T6 OX=10666 GN=nrdA PE=3 SV=1
20	P32282	7.81e-70	246	754	0.280	0.294	RIR1_BPT4 Ribonucleoside-diphosphate reductase subunit alpha OS=Enterobacteria phage T4 OX=10665 GN=NRDA PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03477 ATP-cone	5.2e-15	67.1	ATP cone domain
2	PF02867 Ribonuc_red_lgC	5.1e-193	654.0	Ribonucleotide reductase, barrel domain
3	PF00317 Ribonuc_red_lgN	8.8e-20	81.8	Ribonucleotide reductase, all-alpha domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300738

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251810	0.999	Ribonucleoside-diphosphate reductase subunit M2 B
2	9606.ENSP00000353770	0.999	Ribonucleoside-diphosphate reductase subunit M2
3	9606.ENSP00000307288	0.991	DNA replication licensing factor MCM7
4	9606.ENSP00000216122	0.990	DNA replication licensing factor MCM5
5	9606.ENSP00000262105	0.988	DNA replication licensing factor MCM4
6	9606.ENSP00000368458	0.985	Proliferating cell nuclear antigen
7	9606.ENSP00000315644	0.983	Thymidylate synthase
8	9606.ENSP00000264156	0.981	DNA replication licensing factor MCM6
9	9606.ENSP00000265056	0.980	DNA replication licensing factor MCM2
10	9606.ENSP00000480987	0.980	DNA replication licensing factor MCM3
11	9606.ENSP00000370376	0.974	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
12	9606.ENSP00000378699	0.967	Cyclin-dependent kinase 1
13	9606.ENSP00000368349	0.963	DNA polymerase alpha catalytic subunit
14	9606.ENSP00000304802	0.962	Thymidylate kinase
15	9606.ENSP00000209728	0.960	Cell division control protein 6 homolog
16	9606.ENSP00000305480	0.958	Flap endonuclease 1
17	9606.ENSP00000350491	0.957	DNA primase small subunit
18	9606.ENSP00000369314	0.957	Glutaredoxin-1
19	9606.ENSP00000363641	0.950	Thioredoxin
20	9606.ENSP00000360939	0.946	UMP-CMP kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004748	1.000	ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor
GO:0097159	0.967	organic cyclic compound binding
GO:1901363	0.966	heterocyclic compound binding
GO:0042802	0.906	identical protein binding
GO:0000166	0.807	nucleotide binding
GO:0017076	0.570	purine nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.994	organic substance metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0044238	0.992	primary metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:1901360	0.976	organic cyclic compound metabolic process
GO:0046483	0.975	heterocycle metabolic process
GO:0006139	0.966	nucleobase-containing compound metabolic process
GO:0055086	0.926	nucleobase-containing small molecule metabolic process
GO:0065007	0.825	biological regulation
GO:0050789	0.824	regulation of biological process
GO:0050794	0.689	regulation of cellular process
GO:0043170	0.654	macromolecule metabolic process
GO:0090304	0.555	nucleic acid metabolic process
GO:0044260	0.526	cellular macromolecule metabolic process
GO:0050896	0.514	response to stimulus
GO:0071840	0.450	cellular component organization or biogenesis
GO:0048518	0.423	positive regulation of biological process
GO:0016043	0.407	cellular component organization
GO:0006259	0.371	DNA metabolic process
GO:0048522	0.348	positive regulation of cellular process
GO:1901576	0.328	organic substance biosynthetic process
GO:0044249	0.321	cellular biosynthetic process
GO:0044271	0.309	cellular nitrogen compound biosynthetic process
GO:0009117	0.309	nucleotide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.999	protein-containing complex
GO:0005634	0.985	nucleus
GO:1902494	0.979	catalytic complex
GO:0005971	0.930	ribonucleoside-diphosphate reductase complex
GO:0070013	0.879	intracellular organelle lumen
GO:0031981	0.747	nuclear lumen
GO:0005654	0.677	nucleoplasm
GO:0043232	0.489	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23252	1.000	[thioredoxin]-disulfide + a 2'-deoxyribonucleoside 5'-diphosphate + H2O = [thioredoxin]-dithiol + a ribonucleoside 5'-diphosphate
EC:1.17.4.1	1.000	ribonucleoside-diphosphate reductase.

[back to server]