StarFunc result for job id P24001

User Input

>input (234 residues)
MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLC
LSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLE
KERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKV
VALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24001	1.000	1.000	1.849E-34	234	1.000	1.000	P24001.pdb.gz	IL32_HUMAN Interleukin-32 OS=Homo sapiens OX=9606 GN=IL32 PE=1 SV=3
2	AFDB:Q9R1Q6	0.255	0.232	2.029E-1	263	0.141	0.125	Q9R1Q6.pdb.gz	T176B_MOUSE Transmembrane protein 176B OS=Mus musculus OX=10090 GN=Tmem176b PE=1 SV=1
3	AFDB:E9QCU8	0.182	0.042	2.669E-1	1288	0.124	0.023	E9QCU8.pdb.gz
4	AFDB:A0A0B4KEW6	0.192	0.101	3.917E-1	502	0.128	0.060	A0A0B4KEW6.pdb.gz	A0A0B4KEW6_DROME Amphiphysin, isoform B OS=Drosophila melanogaster OX=7227 GN=Amph PE=1 SV=1
5	AFDB:A0A0B4KFR7	0.178	0.120	4.138E-1	373	0.137	0.086	A0A0B4KFR7.pdb.gz	A0A0B4KFR7_DROME Amphiphysin, isoform C OS=Drosophila melanogaster OX=7227 GN=Amph PE=1 SV=1
6	AFDB:F1Q6Q6	0.219	0.048	4.617E-1	1253	0.103	0.019	F1Q6Q6.pdb.gz	F1Q6Q6_DANRE Unconventional myosin-VI OS=Danio rerio OX=7955 GN=myo6a PE=1 SV=1
7	AFDB:Q9UM54	0.128	0.040	4.617E-1	1294	0.141	0.026	Q9UM54.pdb.gz	MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6 PE=1 SV=4
8	AFDB:Q8WYH8	0.272	0.265	8.913E-1	240	0.107	0.104	Q8WYH8.pdb.gz	ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens OX=9606 GN=ING5 PE=1 SV=1
9	AFDB:Q64331	0.180	0.050	9.415E-1	1265	0.103	0.019	Q64331.pdb.gz	MYO6_MOUSE Unconventional myosin-VI OS=Mus musculus OX=10090 GN=Myo6 PE=1 SV=2
10	AFDB:E7FGA0	0.170	0.039	9.946E-1	1267	0.103	0.019	E7FGA0.pdb.gz
11	PDB:6wlw0	0.256	0.276	1.040	204	0.073	0.083	6wlw0.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
12	PDB:2mgyA	0.151	0.203	1.226	169	0.090	0.124	2mgyA.pdb.gz	Structure of the mitochondrial translocator protein in complex with a diagnostic ligand.
13	PDB:7e9hR	0.177	0.069	1.445	766	0.073	0.022	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
14	PDB:3aouA	0.208	0.263	1.799	156	0.060	0.090	3aouA.pdb.gz	Structure of the rotor ring modified with N,N'-dicyclohexylcarbodiimide of the Na+-transporting vacuolar ATPase.
15	PDB:6w2xB	0.262	0.115	2.120	669	0.068	0.024	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
16	PDB:1xlyB	0.202	0.227	2.499	184	0.103	0.130	1xlyB.pdb.gz
17	PDB:7e9gR	0.200	0.080	2.499	769	0.068	0.021	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
18	PDB:7uw9i	0.176	0.253	2.499	156	0.077	0.115	7uw9i.pdb.gz
19	PDB:3zhwA	0.170	0.228	2.640	154	0.098	0.149	3zhwA.pdb.gz	X-Ray Crystallographic Structural Characteristics of Arabidopsis Hemoglobin I and Their Functional Implications
20	PDB:2y6xA	0.117	0.206	2.789	109	0.085	0.183	2y6xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24001	3.00e-176	485	234	1.000	1.000	IL32_HUMAN Interleukin-32 OS=Homo sapiens OX=9606 GN=IL32 PE=1 SV=3
2	C6GKH1	2.78e-109	313	168	0.718	1.000	C6GKH1_HUMAN Interleukin 32 OS=Homo sapiens OX=9606 GN=IL32 PE=1 SV=1
3	Q08379	0.62	33.5	1002	0.107	0.025	GOGA2_HUMAN Golgin subfamily A member 2 OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=3
4	B7ZC06	0.66	33.5	997	0.107	0.025	B7ZC06_HUMAN Golgin A2 OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=4
5	A0A087WYC0	0.94	33.1	796	0.107	0.031	A0A087WYC0_HUMAN Golgin A2 (Fragment) OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=2
6	Q8I495	5.2	30.8	2207	0.073	0.008	Q8I495_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0500100 PE=4 SV=1
7	P41003	5.3	30.8	1172	0.081	0.016	SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut14 PE=1 SV=2
8	A0A0R4IJ71	6.9	30.4	4506	0.090	0.005	A0A0R4IJ71_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=2
9	E9QCV2	7.1	30.4	4530	0.090	0.005	E9QCV2_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=1
10	Q8CHX7	8.0	30.0	500	0.094	0.044	RFTN2_MOUSE Raftlin-2 OS=Mus musculus OX=10090 GN=Rftn2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19174 DUF5856	3.5e+02	13.7	Family of unknown function (DUF5856)
2	PF15225 IL32	6.2e-41	150.2	Interleukin 32

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000022790

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000000767	0.859	Proteinase 3
2	9593.ENSGGOP00000003154	0.838	Protein kinase C delta type
3	9593.ENSGGOP00000000769	0.718	Complement factor D (adipsin)
4	9593.ENSGGOP00000020538	0.644	Signal transducer and activator of transcription 3 (acute-phase response factor)
5	9593.ENSGGOP00000004981	0.606	Nucleotide-binding oligomerization domain containing 1
6	9593.ENSGGOP00000013225	0.585	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
7	9593.ENSGGOP00000012674	0.546	Hepatocyte growth factor receptor
8	9593.ENSGGOP00000011680	0.545	Calcium-independent, phospholipid- and diacylglycerol (DAG)- dependent serine/threonine-protein kinase that plays essential roles in the regulation of multiple cellular processes linked to cytoskeletal proteins, such as cell adhesion, motility, migration and cell cycle, functions in neuron growth and ion channel regulation, and is involved in immune response, cancer cell invasion and regulation of apoptosis. Mediates cell adhesion to the extracellular matrix via integrin- dependent signaling, by mediating angiotensin-2-induced activation of integrin beta-1 (ITGB1) in cardiac fibroblast [...]
9	9593.ENSGGOP00000012925	0.533	Heparan sulfate proteoglycan 2
10	9593.ENSGGOP00000000768	0.526	Elastase, neutrophil expressed

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050896	0.991	response to stimulus
GO:0009987	0.985	cellular process
GO:0044093	0.981	positive regulation of molecular function
GO:0051239	0.979	regulation of multicellular organismal process
GO:0010628	0.979	positive regulation of gene expression
GO:0002376	0.972	immune system process
GO:0001817	0.969	regulation of cytokine production
GO:0006955	0.961	immune response
GO:0006952	0.957	defense response
GO:0051240	0.955	positive regulation of multicellular organismal process
GO:0048519	0.948	negative regulation of biological process
GO:0001819	0.946	positive regulation of cytokine production
GO:0051098	0.890	regulation of binding
GO:0050792	0.885	regulation of viral process
GO:0051101	0.836	regulation of DNA binding
GO:0050794	0.807	regulation of cellular process
GO:1903900	0.741	regulation of viral life cycle
GO:0007155	0.739	cell adhesion
GO:0048525	0.665	negative regulation of viral process
GO:0051099	0.663	positive regulation of binding
GO:2000677	0.606	regulation of transcription regulatory region DNA binding
GO:0043388	0.593	positive regulation of DNA binding
GO:0048522	0.583	positive regulation of cellular process
GO:1903901	0.531	negative regulation of viral life cycle
GO:0080090	0.496	regulation of primary metabolic process
GO:0031323	0.439	regulation of cellular metabolic process
GO:0042221	0.417	response to chemical
GO:0051171	0.404	regulation of nitrogen compound metabolic process
GO:0009605	0.392	response to external stimulus
GO:0051716	0.366	cellular response to stimulus
GO:0044419	0.345	biological process involved in interspecies interaction between organisms
GO:0009607	0.309	response to biotic stimulus
GO:0009889	0.305	regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005615	0.999	extracellular space
GO:0005829	0.998	cytosol
GO:0043226	0.784	organelle
GO:0043229	0.640	intracellular organelle
GO:0043227	0.355	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]