StarFunc result for job id P24043

User Input

>input (1400 residues)
MPGAAGVLLLLLLSGGLGGVQAQRPQQQRQSQAHQQRGLFPAVLNLASNALITTNATCGE
KGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIE
YHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLY
NIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARY
IRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDP
ATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVA
RRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIG
SLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNED
PCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDM
SGWYLTDLPGRIRVAPQQDDLDSPQQISISNAEARQALPHSYYWSAPAPYLGNKLPAVGG
QLTFTISYDLEEEEEDTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESF
TIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAA
VEVCQCPPGYTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHT
GGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYT
GPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCEL
CADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQS
ARGCVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLG
NNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCN
CHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNV
EGIHCDRCRPGKFGLDAKNPLGCSSCYCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDE
ALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFE
AREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRV
HRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKC
DCPLGYSGLSCEACLPGFYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2KI51	0.309	0.496	6.692E-100	845	0.290	0.480	A0A0G2KI51.pdb.gz
2	AFDB:P11047	0.232	0.204	9.339E-93	1609	0.264	0.230	P11047.pdb.gz	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
3	AFDB:Q1LVF0	0.225	0.200	2.504E-92	1593	0.257	0.226	Q1LVF0.pdb.gz	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
4	AFDB:P15215	0.218	0.189	2.587E-91	1639	0.249	0.213	P15215.pdb.gz	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
5	AFDB:Q9Y6N6	0.253	0.227	8.103E-91	1575	0.266	0.236	Q9Y6N6.pdb.gz	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3
6	AFDB:Q18823	0.242	0.216	1.676E-90	1633	0.259	0.222	Q18823.pdb.gz	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3
7	AFDB:Q9R0B6	0.248	0.222	9.784E-90	1581	0.259	0.230	Q9R0B6.pdb.gz	LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus OX=10090 GN=Lamc3 PE=1 SV=2
8	AFDB:F1QPJ1	0.204	0.176	1.085E-89	1643	0.259	0.220	F1QPJ1.pdb.gz	F1QPJ1_DANRE Laminin subunit gamma-3 OS=Danio rerio OX=7955 GN=lamc3 PE=4 SV=1
9	AFDB:B7ZDA6	0.254	0.203	6.442E-79	1782	0.238	0.187	B7ZDA6.pdb.gz	B7ZDA6_DANRE Laminin subunit beta-2 precursor OS=Danio rerio OX=7955 GN=si:dkey-32e6.2 PE=1 SV=1
10	AFDB:A0A0R4IDN1	0.260	0.208	1.140E-78	1785	0.234	0.183	A0A0R4IDN1.pdb.gz
11	PDB:1xpwA	0.077	0.652	7.458E-5	143	0.022	0.217	1xpwA.pdb.gz
12	PDB:1k12A	0.081	0.629	1.999E-4	158	0.018	0.158	1k12A.pdb.gz	A novel fucose recognition fold involved in innate immunity.
13	PDB:8a3tA	0.090	0.496	6.595E-4	219	0.019	0.119	8a3tA.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
14	PDB:4g1eB	0.054	0.088	1.513E-3	709	0.035	0.069	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
15	PDB:7qe7L	0.084	0.540	1.594E-3	183	0.019	0.142	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
16	PDB:7ufgB	0.080	0.089	1.862E-3	1182	0.068	0.080	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:3wsoA	0.066	0.253	4.272E-3	252	0.012	0.067	3wsoA.pdb.gz
18	PDB:2e31A	0.062	0.259	4.499E-3	246	0.019	0.106	2e31A.pdb.gz
19	PDB:7drtB	0.074	0.174	6.470E-3	496	0.021	0.058	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
20	PDB:2wuxA	0.058	0.232	7.560E-3	213	0.016	0.108	2wuxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JWX2	0.0	2577	3121	0.862	0.387	A0A0G2JWX2_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=1 SV=1
2	A0A8I5ZPP7	0.0	2566	3137	0.862	0.385	A0A8I5ZPP7_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=1 SV=1
3	F1M614	0.0	2577	3117	0.862	0.387	F1M614_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=4 SV=4
4	F1MMT2	0.0	2612	1964	0.891	0.635	F1MMT2_BOVIN Laminin subunit alpha 2 OS=Bos taurus OX=9913 GN=LAMA2 PE=4 SV=3
5	G5ECE3	0.0	966	3102	0.415	0.187	LAM3_CAEEL Laminin subunit alpha lam-3 OS=Caenorhabditis elegans OX=6239 GN=lam-3 PE=1 SV=1
6	G8IHU0	0.0	1749	3078	0.598	0.272	G8IHU0_DANRE Laminin alpha 2 chain short splice variant OS=Danio rerio OX=7955 GN=Lama2 PE=1 SV=1
7	P19137	0.0	1611	3083	0.543	0.247	LAMA1_MOUSE Laminin subunit alpha-1 OS=Mus musculus OX=10090 GN=Lama1 PE=1 SV=2
8	P24043	0.0	2957	3122	1.000	0.448	LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4
9	P25391	0.0	1620	3075	0.549	0.250	LAMA1_HUMAN Laminin subunit alpha-1 OS=Homo sapiens OX=9606 GN=LAMA1 PE=1 SV=2
10	Q45H72	0.0	1459	3075	0.506	0.231	Q45H72_DANRE Laminin alpha 1 OS=Danio rerio OX=7955 GN=lama1 PE=1 SV=1
11	Q60675	0.0	2597	3118	0.871	0.391	LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus OX=10090 GN=Lama2 PE=1 SV=2
12	Q8IP51	0.0	746	3375	0.366	0.152	Q8IP51_DROME Wing blister, isoform B OS=Drosophila melanogaster OX=7227 GN=wb PE=4 SV=1
13	Q9XZC9	0.0	745	3367	0.366	0.152	Q9XZC9_DROME Laminin alpha1,2 OS=Drosophila melanogaster OX=7227 GN=wb PE=2 SV=1
14	R9PY40	0.0	746	3001	0.366	0.171	R9PY40_DROME Wing blister, isoform G OS=Drosophila melanogaster OX=7227 GN=wb PE=4 SV=1
15	F1MAA7	1.88e-169	551	1607	0.269	0.234	F1MAA7_RAT Laminin subunit gamma 1 OS=Rattus norvegicus OX=10116 GN=Lamc1 PE=1 SV=1
16	P02468	4.12e-169	550	1607	0.273	0.238	LAMC1_MOUSE Laminin subunit gamma-1 OS=Mus musculus OX=10090 GN=Lamc1 PE=1 SV=2
17	P11047	1.20e-166	543	1609	0.270	0.235	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
18	F1MD77	5.60e-166	541	1608	0.268	0.233	F1MD77_BOVIN Laminin subunit gamma 1 OS=Bos taurus OX=9913 GN=LAMC1 PE=1 SV=2
19	Q1LVF0	8.55e-160	525	1593	0.264	0.232	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
20	Q9Y6N6	2.65e-158	520	1575	0.270	0.240	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00052 Laminin_B	5.7e-61	215.8	Laminin B (Domain IV)
2	PF00053 Laminin_EGF	1.9e-87	298.5	Laminin EGF domain
3	PF00055 Laminin_N	2.7e-61	218.6	Laminin N-terminal (Domain VI)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400365

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000442600	0.999	Dystroglycan
2	9606.ENSP00000354923	0.986	Dystrophin
3	9606.ENSP00000452120	0.966	Integrin alpha-7
4	9606.ENSP00000356515	0.953	Utrophin
5	9606.ENSP00000386896	0.952	Integrin alpha-6
6	9606.ENSP00000222399	0.950	Laminin subunit beta-1
7	9606.ENSP00000007722	0.947	Integrin alpha-3
8	9606.ENSP00000375778	0.945	Laminin subunit beta-3
9	9606.ENSP00000379350	0.944	Integrin beta-1
10	9606.ENSP00000388325	0.942	Laminin subunit beta-2
11	9606.ENSP00000282588	0.939	Integrin alpha-1
12	9606.ENSP00000296585	0.939	Integrin alpha-2
13	9606.ENSP00000368678	0.936	Agrin
14	9606.ENSP00000258341	0.934	Laminin subunit gamma-1
15	9606.ENSP00000230538	0.931	Laminin subunit alpha-4
16	9606.ENSP00000200181	0.930	Integrin beta-4
17	9606.ENSP00000355645	0.930	Actin, alpha skeletal muscle
18	9606.ENSP00000354360	0.929	Laminin subunit gamma-3
19	9606.ENSP00000252999	0.925	Laminin subunit alpha-5
20	9606.ENSP00000324532	0.925	Laminin subunit alpha-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	1.000	structural molecule activity
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.982	anatomical structure development
GO:0009987	0.958	cellular process
GO:0032501	0.952	multicellular organismal process
GO:0007275	0.929	multicellular organism development
GO:0007422	0.899	peripheral nervous system development
GO:0048869	0.856	cellular developmental process
GO:0030154	0.822	cell differentiation
GO:0042063	0.778	gliogenesis
GO:0010001	0.521	glial cell differentiation
GO:0014037	0.491	Schwann cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0062023	0.985	collagen-containing extracellular matrix
GO:0005576	0.978	extracellular region
GO:0005604	0.970	basement membrane
GO:0030054	0.856	cell junction
GO:0045202	0.445	synapse
GO:0016020	0.429	membrane
GO:0120025	0.390	plasma membrane bounded cell projection
GO:0043005	0.370	neuron projection
GO:0005886	0.356	plasma membrane
GO:0032991	0.318	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]