StarFunc result for job id P24071

User Input

>input (287 residues)
MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQL
MIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVT
GLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSL
GPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNLIRMAVAGLVLVA
LLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24071	1.000	1.000	9.036E-54	287	1.000	1.000	P24071.pdb.gz	FCAR_HUMAN Immunoglobulin alpha Fc receptor OS=Homo sapiens OX=9606 GN=FCAR PE=1 SV=1
2	AFDB:A0A024R4N4	0.591	0.635	2.613E-37	265	0.913	0.989	A0A024R4N4.pdb.gz
3	AFDB:Q9HCN6	0.569	0.486	8.281E-22	339	0.355	0.301	Q9HCN6.pdb.gz	GPVI_HUMAN Platelet glycoprotein VI OS=Homo sapiens OX=9606 GN=GP6 PE=1 SV=4
4	AFDB:Q61450	0.580	0.552	9.371E-21	303	0.321	0.304	Q61450.pdb.gz	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
5	AFDB:P0C191	0.564	0.520	1.163E-20	313	0.331	0.304	P0C191.pdb.gz	GPVI_MOUSE Platelet glycoprotein VI OS=Mus musculus OX=10090 GN=Gp6 PE=1 SV=2
6	AFDB:Q8C567	0.605	0.541	1.889E-20	325	0.334	0.295	Q8C567.pdb.gz	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2
7	AFDB:O76036	0.581	0.551	2.220E-20	304	0.352	0.332	O76036.pdb.gz	NCTR1_HUMAN Natural cytotoxicity triggering receptor 1 OS=Homo sapiens OX=9606 GN=NCR1 PE=1 SV=1
8	AFDB:Q8NHJ6	0.562	0.376	2.220E-20	448	0.331	0.212	Q8NHJ6.pdb.gz	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
9	AFDB:Q64281	0.590	0.511	2.343E-20	335	0.345	0.296	Q64281.pdb.gz	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
10	AFDB:Q28109	0.630	0.679	4.476E-20	264	0.324	0.352	Q28109.pdb.gz	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
11	PDB:6dldD	0.251	0.265	7.719E-8	269	0.108	0.115	6dldD.pdb.gz
12	PDB:6dlfA	0.255	0.302	4.827E-7	236	0.098	0.119	6dlfA.pdb.gz
13	PDB:5c6wJ	0.260	0.306	5.377E-7	238	0.084	0.101	5c6wJ.pdb.gz
14	PDB:5c7kF	0.267	0.345	1.274E-6	212	0.098	0.132	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
15	PDB:5oj2B	0.239	0.135	1.961E-6	692	0.111	0.046	5oj2B.pdb.gz
16	PDB:1e4wL	0.282	0.358	7.967E-6	214	0.105	0.140	1e4wL.pdb.gz	Cross-Reactive Binding of Cyclic Peptides to an Anti-Tgf Alpha Antibody Fab Fragment: An X-Ray Structural and Thermodynamic Analysis
17	PDB:4hixL	0.264	0.327	7.967E-6	219	0.087	0.114	4hixL.pdb.gz	Bapineuzumab captures the N-terminus of the Alzheimer's disease amyloid-beta peptide in a helical conformation.
18	PDB:1clyL	0.268	0.342	8.409E-6	217	0.098	0.129	1clyL.pdb.gz	The x-ray structure of an anti-tumour antibody in complex with antigen.
19	PDB:1orqA	0.276	0.353	1.043E-5	215	0.111	0.149	1orqA.pdb.gz
20	PDB:1k4dB	0.266	0.342	1.162E-5	212	0.087	0.118	1k4dB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24071	0.0	602	287	1.000	1.000	FCAR_HUMAN Immunoglobulin alpha Fc receptor OS=Homo sapiens OX=9606 GN=FCAR PE=1 SV=1
2	Q28109	1.50e-40	143	264	0.362	0.394	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
3	O76036	2.87e-39	141	304	0.348	0.329	NCTR1_HUMAN Natural cytotoxicity triggering receptor 1 OS=Homo sapiens OX=9606 GN=NCR1 PE=1 SV=1
4	A6NI73	2.10e-38	139	299	0.341	0.328	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
5	Q9HCN6	3.03e-38	139	339	0.331	0.280	GPVI_HUMAN Platelet glycoprotein VI OS=Homo sapiens OX=9606 GN=GP6 PE=1 SV=4
6	P0C191	1.84e-37	136	313	0.289	0.265	GPVI_MOUSE Platelet glycoprotein VI OS=Mus musculus OX=10090 GN=Gp6 PE=1 SV=2
7	Q8C567	4.86e-37	135	325	0.338	0.298	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2
8	Q8N149	2.11e-35	134	483	0.341	0.203	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
9	Q8NHL6	1.60e-32	128	650	0.317	0.140	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
10	Q8N6C8	2.14e-30	120	439	0.303	0.198	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
11	P59901	5.97e-30	119	499	0.282	0.162	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
12	Q8N423	9.92e-30	120	597	0.303	0.146	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
13	O75022	1.04e-29	120	631	0.279	0.127	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
14	Q8NHJ6	4.56e-29	117	448	0.289	0.185	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
15	B6A8C7	8.76e-29	112	271	0.296	0.314	TARM1_HUMAN T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Homo sapiens OX=9606 GN=TARM1 PE=1 SV=2
16	Q61450	1.16e-28	113	303	0.275	0.261	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
17	Q99706	2.13e-28	114	377	0.328	0.249	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
18	O75019	3.24e-28	115	489	0.303	0.178	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
19	P43626	6.58e-24	101	348	0.251	0.207	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
20	Q14954	8.87e-24	100	304	0.275	0.260	KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 OS=Homo sapiens OX=9606 GN=KIR2DS1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01691 Adeno_E1B_19K	2.1e+02	12.8	Adenovirus E1B 19K protein / small t-antigen
2	PF00047 ig	2.3e-05	35.8	Immunoglobulin domain
3	PF13895 Ig_2	6.3e-09	47.3	Immunoglobulin domain
4	PF13927 Ig_3	0.00046	32.0	Immunoglobulin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347714

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358165	0.904	High affinity immunoglobulin gamma Fc receptor I
2	9606.ENSP00000478289	0.821	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]
3	9606.ENSP00000329507	0.757	CMRF35-like molecule 6
4	9606.ENSP00000357097	0.724	High affinity immunoglobulin epsilon receptor subunit alpha
5	9606.ENSP00000262629	0.697	TYRO protein tyrosine kinase-binding protein
6	9606.ENSP00000255040	0.694	Serum amyloid P-component
7	9606.ENSP00000271450	0.694	Low affinity immunoglobulin gamma Fc region receptor II-a
8	9606.ENSP00000289902	0.680	High affinity immunoglobulin epsilon receptor subunit gamma
9	9606.ENSP00000393675	0.680	Mitoguardin 1
10	9606.ENSP00000255030	0.678	C-reactive protein
11	9606.ENSP00000222224	0.668	Leukocyte receptor cluster member 1
12	9606.ENSP00000316491	0.656	High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
13	9606.ENSP00000348888	0.638	Polymeric immunoglobulin receptor
14	9606.ENSP00000351497	0.630	Low affinity immunoglobulin gamma Fc region receptor II-b
15	9606.ENSP00000467123	0.625	NACHT, LRR and PYD domains-containing protein 7
16	9606.ENSP00000221466	0.620	IgG receptor FcRn large subunit p51
17	9606.ENSP00000318374	0.601	Leukocyte receptor cluster member 8
18	9606.ENSP00000353224	0.580	Transferrin receptor protein 1
19	9606.ENSP00000302896	0.549	Ribosomal protein S9
20	9606.ENSP00000254801	0.527	Immunoglobulin J chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.999	signaling receptor activity
GO:0044877	0.959	protein-containing complex binding
GO:0004888	0.898	transmembrane signaling receptor activity
GO:0019865	0.771	immunoglobulin binding
GO:0140375	0.637	immune receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0051716	0.995	cellular response to stimulus
GO:0007165	0.994	signal transduction
GO:0002682	0.991	regulation of immune system process
GO:0006955	0.986	immune response
GO:0048518	0.981	positive regulation of biological process
GO:0070887	0.960	cellular response to chemical stimulus
GO:0009607	0.956	response to biotic stimulus
GO:0007166	0.947	cell surface receptor signaling pathway
GO:0032501	0.932	multicellular organismal process
GO:0048583	0.930	regulation of response to stimulus
GO:0006952	0.928	defense response
GO:0071310	0.925	cellular response to organic substance
GO:0045321	0.906	leukocyte activation
GO:0034097	0.892	response to cytokine
GO:0044419	0.882	biological process involved in interspecies interaction between organisms
GO:0071345	0.864	cellular response to cytokine stimulus
GO:0048522	0.814	positive regulation of cellular process
GO:0051707	0.773	response to other organism
GO:0002252	0.740	immune effector process
GO:0050776	0.720	regulation of immune response
GO:0002764	0.708	immune response-regulating signaling pathway
GO:0002684	0.694	positive regulation of immune system process
GO:0080134	0.613	regulation of response to stress
GO:0019222	0.567	regulation of metabolic process
GO:0002768	0.555	immune response-regulating cell surface receptor signaling pathway
GO:0048584	0.442	positive regulation of response to stimulus
GO:0051239	0.421	regulation of multicellular organismal process
GO:0060255	0.421	regulation of macromolecule metabolic process
GO:0009893	0.378	positive regulation of metabolic process
GO:0048519	0.330	negative regulation of biological process
GO:0010468	0.322	regulation of gene expression
GO:0080090	0.314	regulation of primary metabolic process
GO:0031323	0.309	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.987	organelle
GO:0012505	0.982	endomembrane system
GO:0043229	0.978	intracellular organelle
GO:0043227	0.976	membrane-bounded organelle
GO:0005737	0.976	cytoplasm
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0031982	0.917	vesicle
GO:0030659	0.898	cytoplasmic vesicle membrane
GO:0030667	0.884	secretory granule membrane
GO:0070820	0.496	tertiary granule
GO:0070821	0.423	tertiary granule membrane
GO:0042581	0.340	specific granule
GO:0005576	0.305	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]