StarFunc result for job id P24298

User Input

>input (496 residues)
MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPF
TEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSL
GAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRT
GVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVI
NPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPY
AGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDL
VVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQL
PPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLL
LEKLSRFHAKFTLEYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24298	1.000	1.000	1.325E-93	496	1.000	1.000	P24298.pdb.gz	ALAT1_HUMAN Alanine aminotransferase 1 OS=Homo sapiens OX=9606 GN=GPT PE=1 SV=3
2	AFDB:P25409	0.994	0.994	1.285E-86	496	0.879	0.879	P25409.pdb.gz	ALAT1_RAT Alanine aminotransferase 1 OS=Rattus norvegicus OX=10116 GN=Gpt PE=1 SV=2
3	AFDB:A0A0G2JV84	0.968	0.883	9.217E-72	544	0.669	0.610	A0A0G2JV84.pdb.gz	A0A0G2JV84_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1
4	AFDB:Q9VYD9	0.967	0.836	3.635E-63	575	0.520	0.449	Q9VYD9.pdb.gz	Q9VYD9_DROME alanine transaminase OS=Drosophila melanogaster OX=7227 GN=ALT PE=1 SV=3
5	PDB:3ihjA	0.857	0.921	4.080E-59	461	0.615	0.662	3ihjA.pdb.gz	Human glutamate pyruvate transaminase 2
6	AFDB:Q9LR30	0.927	0.956	1.537E-55	481	0.440	0.453	Q9LR30.pdb.gz	GGT1_ARATH Glutamate--glyoxylate aminotransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GGAT1 PE=1 SV=1
7	AFDB:Q9LDV4	0.944	0.868	1.883E-55	540	0.468	0.430	Q9LDV4.pdb.gz	ALAT2_ARATH Alanine aminotransferase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALAAT2 PE=1 SV=1
8	AFDB:F4I7I0	0.946	0.865	2.192E-55	543	0.468	0.427	F4I7I0.pdb.gz	ALAT1_ARATH Alanine aminotransferase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALAAT1 PE=1 SV=1
9	AFDB:P52893	0.927	0.779	8.203E-55	592	0.435	0.365	P52893.pdb.gz	ALAM_YEAST Probable alanine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALT1 PE=1 SV=1
10	AFDB:Q7TP13	0.897	0.569	4.606E-54	789	0.573	0.360	Q7TP13.pdb.gz	Q7TP13_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1
11	AFDB:P52892	0.924	0.904	5.264E-53	507	0.444	0.434	P52892.pdb.gz	ALAT_YEAST Probable alanine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALT2 PE=1 SV=1
12	PDB:4cvqA	0.727	0.884	2.569E-29	404	0.220	0.270	4cvqA.pdb.gz	Structural analysis and mutant growth properties reveal distinctive enzymatic and cellular roles for the three major L-alanine transaminases of Escherichia coli.
13	PDB:1b8gB	0.631	0.728	1.501E-22	425	0.188	0.219	1b8gB.pdb.gz	Structure of 1-aminocyclopropane-1-carboxylate synthase, a key enzyme in the biosynthesis of the plant hormone ethylene.
14	PDB:5yhvA	0.702	0.872	7.238E-22	394	0.198	0.249	5yhvA.pdb.gz	Crystal structure of an aminotransferase from Mycobacterium tuberculosis
15	PDB:5wmlA	0.710	0.861	4.980E-21	404	0.165	0.203	5wmlA.pdb.gz	Structural basis for substrate recognition and inhibition of prephenate aminotransferase from Arabidopsis.
16	PDB:3fvsA	0.659	0.769	3.792E-20	419	0.181	0.215	3fvsA.pdb.gz	Structural insight into the inhibition of human kynurenine aminotransferase I/glutamine transaminase K
17	PDB:7dlwB	0.611	0.715	9.945E-20	419	0.167	0.198	7dlwB.pdb.gz	Dual activities of ACC synthase: Novel clues regarding the molecular evolution of ACS genes.
18	PDB:2o0rA	0.600	0.760	1.046E-19	385	0.183	0.236	2o0rA.pdb.gz	The Three-dimensional Structure of N-Succinyldiaminopimelate Aminotransferase from Mycobacterium tuberculosis
19	PDB:1u08A	0.644	0.819	2.887E-19	382	0.153	0.199	1u08A.pdb.gz	Crystal structure and reactivity of YbdL from Escherichia coli identify a methionine aminotransferase function
20	PDB:3b46B	0.681	0.786	3.196E-19	425	0.161	0.188	3b46B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JV84	0.0	724	544	0.669	0.610	A0A0G2JV84_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1
2	A0A8I6ACI1	0.0	724	531	0.669	0.625	A0A8I6ACI1_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1
3	A0A8I6ARL0	0.0	723	522	0.669	0.636	A0A8I6ARL0_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=3 SV=1
4	P24298	0.0	1014	496	1.000	1.000	ALAT1_HUMAN Alanine aminotransferase 1 OS=Homo sapiens OX=9606 GN=GPT PE=1 SV=3
5	P25409	0.0	875	496	0.879	0.879	ALAT1_RAT Alanine aminotransferase 1 OS=Rattus norvegicus OX=10116 GN=Gpt PE=1 SV=2
6	Q7KV27	0.0	554	568	0.522	0.456	Q7KV27_DROME alanine transaminase OS=Drosophila melanogaster OX=7227 GN=ALT PE=1 SV=1
7	Q8BGT5	0.0	719	522	0.669	0.636	ALAT2_MOUSE Alanine aminotransferase 2 OS=Mus musculus OX=10090 GN=Gpt2 PE=1 SV=1
8	Q8QZR5	0.0	890	496	0.873	0.873	ALAT1_MOUSE Alanine aminotransferase 1 OS=Mus musculus OX=10090 GN=Gpt PE=1 SV=3
9	Q8T9D5	0.0	554	568	0.522	0.456	Q8T9D5_DROME alanine transaminase OS=Drosophila melanogaster OX=7227 GN=CG1640 PE=2 SV=1
10	Q8TD30	0.0	727	523	0.667	0.633	ALAT2_HUMAN Alanine aminotransferase 2 OS=Homo sapiens OX=9606 GN=GPT2 PE=1 SV=1
11	Q9VYD9	0.0	555	575	0.522	0.450	Q9VYD9_DROME alanine transaminase OS=Drosophila melanogaster OX=7227 GN=ALT PE=1 SV=3
12	A0A8I6GJ17	9.75e-170	498	724	0.542	0.372	A0A8I6GJ17_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1
13	Q7TP13	3.36e-169	498	789	0.540	0.340	Q7TP13_RAT alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1
14	Q9LDV4	1.56e-151	445	540	0.466	0.428	ALAT2_ARATH Alanine aminotransferase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALAAT2 PE=1 SV=1
15	Q9LR30	4.85e-149	436	481	0.440	0.453	GGT1_ARATH Glutamate--glyoxylate aminotransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GGAT1 PE=1 SV=1
16	F4I7I0	5.12e-147	433	543	0.468	0.427	ALAT1_ARATH Alanine aminotransferase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALAAT1 PE=1 SV=1
17	Q9S7E9	4.05e-146	429	481	0.433	0.447	GGT2_ARATH Glutamate--glyoxylate aminotransferase 2 OS=Arabidopsis thaliana OX=3702 GN=GGAT2 PE=1 SV=1
18	P52892	7.01e-139	411	507	0.446	0.436	ALAT_YEAST Probable alanine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALT2 PE=1 SV=1
19	P52893	1.62e-133	400	592	0.444	0.372	ALAM_YEAST Probable alanine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALT1 PE=1 SV=1
20	Q4GYI2	1.81e-126	382	569	0.413	0.360	Q4GYI2_TRYB2 alanine transaminase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3950 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	2.6e-29	114.2	Aminotransferase class I and II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378408

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359539	0.972	Aspartate aminotransferase, cytoplasmic
2	9606.ENSP00000245206	0.963	Aspartate aminotransferase, mitochondrial
3	9606.ENSP00000355518	0.958	Fumarate hydratase, mitochondrial
4	9606.ENSP00000277865	0.954	Glutamate dehydrogenase 1, mitochondrial
5	9606.ENSP00000231420	0.952	Alanine--glyoxylate aminotransferase 2, mitochondrial
6	9606.ENSP00000327589	0.946	Glutamate dehydrogenase 2, mitochondrial
7	9606.ENSP00000302620	0.935	Alanine-glyoxylate aminotransferase
8	9606.ENSP00000293404	0.922	N-acetylglutamate synthase, mitochondrial
9	9606.ENSP00000295897	0.918	Serum albumin
10	9606.ENSP00000308541	0.913	Prothrombin
11	9606.ENSP00000303077	0.883	Putative aspartate aminotransferase, cytoplasmic 2
12	9606.ENSP00000255030	0.882	C-reactive protein
13	9606.ENSP00000364649	0.879	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
14	9606.ENSP00000331897	0.864	Isocitrate dehydrogenase [NADP], mitochondrial
15	9606.ENSP00000379138	0.864	Alpha-fetoprotein
16	9606.ENSP00000264932	0.863	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
17	9606.ENSP00000390265	0.860	Isocitrate dehydrogenase 1, cytosolic
18	9606.ENSP00000380432	0.857	Insulin
19	9606.ENSP00000222673	0.847	2-oxoglutarate dehydrogenase, mitochondrial
20	9606.ENSP00000356953	0.847	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008483	1.000	transaminase activity
GO:0005488	0.997	binding
GO:0005515	0.972	protein binding
GO:0004021	0.657	L-alanine:2-oxoglutarate aminotransferase activity
GO:0097159	0.508	organic cyclic compound binding
GO:0042802	0.458	identical protein binding
GO:1901363	0.418	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0050896	0.962	response to stimulus
GO:0031325	0.959	positive regulation of cellular metabolic process
GO:0051716	0.928	cellular response to stimulus
GO:0080090	0.920	regulation of primary metabolic process
GO:0042221	0.918	response to chemical
GO:0009889	0.911	regulation of biosynthetic process
GO:0070887	0.911	cellular response to chemical stimulus
GO:0010033	0.902	response to organic substance
GO:0006950	0.891	response to stress
GO:0071704	0.888	organic substance metabolic process
GO:0044237	0.885	cellular metabolic process
GO:0071375	0.851	cellular response to peptide hormone stimulus
GO:0044238	0.843	primary metabolic process
GO:0006111	0.818	regulation of gluconeogenesis
GO:0031667	0.810	response to nutrient levels
GO:0045913	0.709	positive regulation of carbohydrate metabolic process
GO:0010676	0.668	positive regulation of cellular carbohydrate metabolic process
GO:0032869	0.651	cellular response to insulin stimulus
GO:0006807	0.534	nitrogen compound metabolic process
GO:1901564	0.432	organonitrogen compound metabolic process
GO:0044281	0.430	small molecule metabolic process
GO:0031326	0.421	regulation of cellular biosynthetic process
GO:0043436	0.342	oxoacid metabolic process
GO:0062013	0.335	positive regulation of small molecule metabolic process
GO:0019752	0.334	carboxylic acid metabolic process
GO:0031328	0.313	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0005615	1.000	extracellular space
GO:0031982	0.981	vesicle
GO:0005829	0.954	cytosol
GO:1903561	0.947	extracellular vesicle
GO:0070062	0.935	extracellular exosome
GO:0043231	0.852	intracellular membrane-bounded organelle
GO:0070013	0.571	intracellular organelle lumen
GO:0012505	0.385	endomembrane system
GO:0005739	0.318	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.6.1.-	1.000	Transaminases.
RHEA:19453	0.657	2-oxoglutarate + L-alanine = L-glutamate + pyruvate
EC:2.6.1.2	0.657	alanine transaminase.

[back to server]