StarFunc result for job id P24311

User Input

>input (80 residues)
MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQV
GIEWNLSPVGRVTPKEWRNQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24311	1.000	1.000	2.508E-13	80	1.000	1.000	P24311.pdb.gz	COX7B_HUMAN Cytochrome c oxidase subunit 7B, mitochondrial OS=Homo sapiens OX=9606 GN=COX7B PE=1 SV=2
2	AFDB:P13183	0.788	0.788	2.550E-11	80	0.787	0.787	P13183.pdb.gz	COX7B_BOVIN Cytochrome c oxidase subunit 7B, mitochondrial OS=Bos taurus OX=9913 GN=COX7B PE=1 SV=3
3	AFDB:P56393	0.739	0.739	2.550E-11	80	0.787	0.787	P56393.pdb.gz	COX7B_MOUSE Cytochrome c oxidase subunit 7B, mitochondrial OS=Mus musculus OX=10090 GN=Cox7b PE=1 SV=1
4	PDB:2y69K	0.607	0.986	6.455E-7	49	0.512	0.837	2y69K.pdb.gz	A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
5	AFDB:Q8IPT0	0.379	0.168	4.799	227	0.125	0.044	Q8IPT0.pdb.gz	Q8IPT0_DROME ER membrane protein complex subunit 10, isoform C OS=Drosophila melanogaster OX=7227 GN=EMC10 PE=1 SV=2
6	AFDB:E5QCE7	0.277	0.123	8.229	217	0.138	0.051	E5QCE7.pdb.gz	E5QCE7_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-14 PE=1 SV=1
7	AFDB:A0A024RDI1	0.285	0.099	8.888	269	0.100	0.030	A0A024RDI1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24311	1.69e-56	169	80	1.000	1.000	COX7B_HUMAN Cytochrome c oxidase subunit 7B, mitochondrial OS=Homo sapiens OX=9606 GN=COX7B PE=1 SV=2
2	P56393	3.20e-46	144	80	0.787	0.787	COX7B_MOUSE Cytochrome c oxidase subunit 7B, mitochondrial OS=Mus musculus OX=10090 GN=Cox7b PE=1 SV=1
3	P13183	3.00e-45	141	80	0.787	0.787	COX7B_BOVIN Cytochrome c oxidase subunit 7B, mitochondrial OS=Bos taurus OX=9913 GN=COX7B PE=1 SV=3
4	Q57Z55	0.66	30.0	1011	0.212	0.017	Q57Z55_TRYB2 Calcium-transporting ATPase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.570 PE=3 SV=1
5	Q8GWG6	1.2	29.3	623	0.188	0.024	MBRL_ARATH Membralin-like protein At1g60995 OS=Arabidopsis thaliana OX=3702 GN=At1g60995 PE=2 SV=1
6	Q80YA3	4.4	27.7	547	0.200	0.029	DDHD1_MOUSE Phospholipase DDHD1 OS=Mus musculus OX=10090 GN=Ddhd1 PE=1 SV=1
7	Q8NEL9	4.6	27.7	900	0.200	0.018	DDHD1_HUMAN Phospholipase DDHD1 OS=Homo sapiens OX=9606 GN=DDHD1 PE=1 SV=2
8	Q9NK54	5.2	27.7	1711	0.163	0.008	CHIF_DROME Protein chiffon OS=Drosophila melanogaster OX=7227 GN=chif PE=1 SV=2
9	Q9ZUU9	5.5	27.3	730	0.237	0.026	AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana OX=3702 GN=ABCG3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05392 COX7B	7.9e-42	152.1	Cytochrome C oxidase chain VIIB
2	PF16020 Deltameth_res	33	15.7	Deltamethrin resistance

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417656

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339720	0.994	Cytochrome c oxidase subunit NDUFA4
2	9606.ENSP00000428895	0.992	Cytochrome c oxidase subunit 6C
3	9606.ENSP00000425759	0.990	Cytochrome c oxidase subunit 7C, mitochondrial
4	9606.ENSP00000258424	0.989	Cytochrome c oxidase subunit 5B, mitochondrial
5	9606.ENSP00000246554	0.986	Cytochrome c oxidase subunit 6B1
6	9606.ENSP00000321260	0.986	Cytochrome c oxidase subunit 8A, mitochondrial
7	9606.ENSP00000229379	0.985	Cytochrome c oxidase subunit 6A1, mitochondrial
8	9606.ENSP00000317780	0.983	Cytochrome c oxidase subunit 5A, mitochondrial
9	9606.ENSP00000457513	0.983	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
10	9606.ENSP00000354499	0.973	Cytochrome c oxidase subunit 1
11	9606.ENSP00000354876	0.972	Cytochrome c oxidase subunit 2
12	9606.ENSP00000354982	0.969	Cytochrome c oxidase subunit 3
13	9606.ENSP00000359098	0.950	Cytochrome c oxidase subunit 7A2, mitochondrial
14	9606.ENSP00000307786	0.932	Cytochrome c
15	9606.ENSP00000367938	0.914	Cytochrome c oxidase subunit 7A-related protein, mitochondrial
16	9606.ENSP00000287490	0.849	Cytochrome c oxidase subunit 6A2, mitochondrial
17	9606.ENSP00000306003	0.827	ATP synthase subunit e, mitochondrial
18	9606.ENSP00000430494	0.827	Cytochrome b-c1 complex subunit 7
19	9606.ENSP00000367939	0.803	Cytochrome b-c1 complex subunit 8
20	9606.ENSP00000379784	0.800	Cytochrome c oxidase subunit 7B2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004129	1.000	cytochrome-c oxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.953	multicellular organismal process
GO:0048856	0.780	anatomical structure development
GO:0007275	0.767	multicellular organism development
GO:0048731	0.737	system development
GO:0009987	0.723	cellular process
GO:0007399	0.716	nervous system development
GO:0007417	0.656	central nervous system development
GO:0008152	0.653	metabolic process
GO:0044237	0.584	cellular metabolic process
GO:0006091	0.497	generation of precursor metabolites and energy
GO:0045333	0.469	cellular respiration
GO:0009060	0.421	aerobic respiration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098803	0.999	respiratory chain complex
GO:0005743	0.999	mitochondrial inner membrane
GO:0070069	0.997	cytochrome complex
GO:0045277	0.994	respiratory chain complex IV
GO:0098798	0.989	mitochondrial protein-containing complex
GO:0098800	0.978	inner mitochondrial membrane protein complex
GO:0005746	0.906	mitochondrial respirasome
GO:0005751	0.827	mitochondrial respiratory chain complex IV

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11436	1.000	4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O
EC:7.1.1.9	1.000	cytochrome-c oxidase.

[back to server]