StarFunc result for job id P24385

User Input

>input (295 residues)
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24385	1.000	1.000	3.191E-38	295	1.000	1.000	P24385.pdb.gz	CCND1_HUMAN G1/S-specific cyclin-D1 OS=Homo sapiens OX=9606 GN=CCND1 PE=1 SV=1
2	AFDB:Q90459	0.893	0.905	1.203E-30	291	0.759	0.770	Q90459.pdb.gz	CCND1_DANRE G1/S-specific cyclin-D1 OS=Danio rerio OX=7955 GN=ccnd1 PE=2 SV=1
3	AFDB:P50755	0.913	0.925	3.763E-30	291	0.769	0.780	P50755.pdb.gz	CCND1_XENLA G1/S-specific cyclin-D1 OS=Xenopus laevis OX=8355 GN=ccnd1 PE=1 SV=1
4	PDB:2w96A	0.789	0.931	5.707E-28	249	0.841	0.996	2w96A.pdb.gz
5	AFDB:P30279	0.862	0.879	2.459E-24	289	0.614	0.626	P30279.pdb.gz	CCND2_HUMAN G1/S-specific cyclin-D2 OS=Homo sapiens OX=9606 GN=CCND2 PE=1 SV=1
6	AFDB:P48961	0.835	0.841	1.248E-20	293	0.485	0.488	P48961.pdb.gz	CCND3_RAT G1/S-specific cyclin-D3 OS=Rattus norvegicus OX=10116 GN=Ccnd3 PE=1 SV=1
7	PDB:3g33B	0.749	0.960	7.631E-18	229	0.441	0.568	3g33B.pdb.gz
8	AFDB:Q9GTQ8	0.799	0.497	1.506E-15	481	0.319	0.195	Q9GTQ8.pdb.gz	Q9GTQ8_DROME Cyclin D OS=Drosophila melanogaster OX=7227 GN=CycD PE=2 SV=1
9	AFDB:A3KPA9	0.787	0.721	3.893E-14	323	0.332	0.303	A3KPA9.pdb.gz	A3KPA9_DANRE LOC567411 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC567411 PE=2 SV=1
10	AFDB:Q9U2M5	0.749	0.553	2.444E-12	405	0.237	0.173	Q9U2M5.pdb.gz	CCND_CAEEL G1/S-specific cyclin-D OS=Caenorhabditis elegans OX=6239 GN=cyd-1 PE=1 SV=1
11	AFDB:Q147G5	0.702	0.481	3.214E-11	436	0.241	0.163	Q147G5.pdb.gz	CCA22_ARATH Cyclin-A2-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA2-2 PE=2 SV=1
12	PDB:1g3nC	0.708	0.887	6.558E-11	233	0.224	0.283	1g3nC.pdb.gz
13	AFDB:P20248	0.727	0.505	7.171E-11	432	0.241	0.164	P20248.pdb.gz	CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens OX=9606 GN=CCNA2 PE=1 SV=2
14	PDB:7nj0C	0.708	0.769	1.184E-8	270	0.190	0.207	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
15	PDB:7b5lY	0.702	0.813	1.235E-8	253	0.227	0.265	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
16	PDB:7kpvB	0.539	0.547	1.085E-4	290	0.112	0.114	7kpvB.pdb.gz
17	PDB:6gzhB	0.571	0.655	2.422E-4	252	0.125	0.147	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
18	PDB:1zp2A	0.550	0.694	3.695E-4	227	0.095	0.123	1zp2A.pdb.gz
19	PDB:5hbhB	0.544	0.590	4.020E-4	270	0.146	0.159	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
20	PDB:7egb9	0.460	0.471	5.180E-4	287	0.163	0.167	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24385	0.0	603	295	1.000	1.000	CCND1_HUMAN G1/S-specific cyclin-D1 OS=Homo sapiens OX=9606 GN=CCND1 PE=1 SV=1
2	P25322	0.0	535	295	0.939	0.939	CCND1_MOUSE G1/S-specific cyclin-D1 OS=Mus musculus OX=10090 GN=Ccnd1 PE=1 SV=1
3	P39948	0.0	536	295	0.939	0.939	CCND1_RAT G1/S-specific cyclin-D1 OS=Rattus norvegicus OX=10116 GN=Ccnd1 PE=2 SV=1
4	Q6FI00	0.0	603	295	1.000	1.000	Q6FI00_HUMAN CCND1 protein OS=Homo sapiens OX=9606 GN=CCND1 PE=2 SV=1
5	Q90459	2.23e-169	472	291	0.763	0.773	CCND1_DANRE G1/S-specific cyclin-D1 OS=Danio rerio OX=7955 GN=ccnd1 PE=2 SV=1
6	P50755	3.20e-168	469	291	0.769	0.780	CCND1_XENLA G1/S-specific cyclin-D1 OS=Xenopus laevis OX=8355 GN=ccnd1 PE=1 SV=1
7	Q6GLD3	1.27e-163	458	291	0.773	0.784	Q6GLD3_XENTR Cyclin D1 OS=Xenopus tropicalis OX=8364 GN=ccnd1 PE=1 SV=1
8	P30280	2.05e-130	374	289	0.634	0.647	CCND2_MOUSE G1/S-specific cyclin-D2 OS=Mus musculus OX=10090 GN=Ccnd2 PE=1 SV=1
9	Q04827	4.43e-129	370	288	0.620	0.635	CCND2_RAT G1/S-specific cyclin-D2 OS=Rattus norvegicus OX=10116 GN=Ccnd2 PE=1 SV=1
10	P30279	2.54e-125	361	289	0.614	0.626	CCND2_HUMAN G1/S-specific cyclin-D2 OS=Homo sapiens OX=9606 GN=CCND2 PE=1 SV=1
11	P30281	7.07e-102	301	292	0.519	0.524	CCND3_HUMAN G1/S-specific cyclin-D3 OS=Homo sapiens OX=9606 GN=CCND3 PE=1 SV=2
12	P30282	2.55e-98	292	292	0.508	0.514	CCND3_MOUSE G1/S-specific cyclin-D3 OS=Mus musculus OX=10090 GN=Ccnd3 PE=1 SV=1
13	P48961	4.10e-96	287	293	0.508	0.512	CCND3_RAT G1/S-specific cyclin-D3 OS=Rattus norvegicus OX=10116 GN=Ccnd3 PE=1 SV=1
14	D3GDI9	9.01e-48	163	297	0.346	0.343	D3GDI9_DANRE Cyclin Dx OS=Danio rerio OX=7955 GN=im:7162084 PE=2 SV=1
15	Q24158	1.26e-47	167	452	0.346	0.226	Q24158_DROME Cyclin D (Fragment) OS=Drosophila melanogaster OX=7227 GN=CycD PE=2 SV=1
16	A3KPA9	2.08e-47	163	323	0.346	0.316	A3KPA9_DANRE LOC567411 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC567411 PE=2 SV=1
17	Q9VXM1	4.18e-47	166	481	0.339	0.208	Q9VXM1_DROME LD22957p OS=Drosophila melanogaster OX=7227 GN=CycD PE=2 SV=1
18	Q9GTQ8	4.41e-47	166	481	0.339	0.208	Q9GTQ8_DROME Cyclin D OS=Drosophila melanogaster OX=7227 GN=CycD PE=2 SV=1
19	Q7KUZ5	4.75e-47	166	477	0.339	0.210	Q7KUZ5_DROME Cyclin D, isoform D OS=Drosophila melanogaster OX=7227 GN=CycD PE=3 SV=1
20	Q9U2M5	7.33e-28	113	405	0.200	0.146	CCND_CAEEL G1/S-specific cyclin-D OS=Caenorhabditis elegans OX=6239 GN=cyd-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02984 Cyclin_C	6.5e-18	76.3	Cyclin, C-terminal domain
2	PF00134 Cyclin_N	4.8e-35	131.5	Cyclin, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000227507

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228872	0.999	Cyclin-dependent kinase inhibitor 1B
2	9606.ENSP00000257904	0.999	Cyclin-dependent kinase 4
3	9606.ENSP00000265734	0.999	Cyclin-dependent kinase 6
4	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
5	9606.ENSP00000384849	0.999	Cyclin-dependent kinase inhibitor 1
6	9606.ENSP00000405330	0.999	Estrogen receptor
7	9606.ENSP00000267163	0.998	Retinoblastoma-associated protein
8	9606.ENSP00000363822	0.998	Androgen receptor
9	9606.ENSP00000418915	0.997	Cyclin-dependent kinase inhibitor 2A
10	9606.ENSP00000263253	0.995	Histone acetyltransferase p300
11	9606.ENSP00000264657	0.995	Signal transducer and activator of transcription 3
12	9606.ENSP00000324806	0.993	Glycogen synthase kinase-3 beta
13	9606.ENSP00000344456	0.993	Catenin beta-1
14	9606.ENSP00000378699	0.992	Cyclin-dependent kinase 1
15	9606.ENSP00000479618	0.991	Myc proto-oncogene protein
16	9606.ENSP00000362649	0.990	Histone deacetylase 1
17	9606.ENSP00000306245	0.987	Proto-oncogene c-Fos
18	9606.ENSP00000432083	0.986	Heat shock cognate 71 kDa protein
19	9606.ENSP00000384863	0.985	Exportin-1
20	9606.ENSP00000418960	0.985	Breast cancer type 1 susceptibility protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.999	protein kinase binding
GO:0140110	0.563	transcription regulator activity
GO:0003712	0.312	transcription coregulator activity
GO:0042826	0.310	histone deacetylase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0009987	0.990	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0048522	0.978	positive regulation of cellular process
GO:0051726	0.971	regulation of cell cycle
GO:0051716	0.970	cellular response to stimulus
GO:0048519	0.967	negative regulation of biological process
GO:0048856	0.966	anatomical structure development
GO:0019222	0.960	regulation of metabolic process
GO:0032501	0.956	multicellular organismal process
GO:0060255	0.953	regulation of macromolecule metabolic process
GO:0031323	0.945	regulation of cellular metabolic process
GO:0044770	0.941	cell cycle phase transition
GO:0042127	0.935	regulation of cell population proliferation
GO:0080090	0.932	regulation of primary metabolic process
GO:0051171	0.932	regulation of nitrogen compound metabolic process
GO:0044772	0.932	mitotic cell cycle phase transition
GO:0042221	0.930	response to chemical
GO:0048523	0.927	negative regulation of cellular process
GO:1901987	0.917	regulation of cell cycle phase transition
GO:0007275	0.904	multicellular organism development
GO:0010033	0.901	response to organic substance
GO:0008284	0.884	positive regulation of cell population proliferation
GO:0007154	0.882	cell communication
GO:1902806	0.875	regulation of cell cycle G1/S phase transition
GO:0023052	0.855	signaling
GO:0007346	0.841	regulation of mitotic cell cycle
GO:1901700	0.828	response to oxygen-containing compound
GO:0045859	0.821	regulation of protein kinase activity
GO:0044843	0.804	cell cycle G1/S phase transition
GO:0006357	0.792	regulation of transcription by RNA polymerase II
GO:0048513	0.781	animal organ development
GO:0042327	0.776	positive regulation of phosphorylation
GO:0010941	0.765	regulation of cell death
GO:0044093	0.762	positive regulation of molecular function
GO:0048731	0.760	system development
GO:0001934	0.755	positive regulation of protein phosphorylation
GO:0043085	0.737	positive regulation of catalytic activity
GO:0031324	0.733	negative regulation of cellular metabolic process
GO:0007165	0.733	signal transduction
GO:0042981	0.729	regulation of apoptotic process
GO:0009890	0.721	negative regulation of biosynthetic process
GO:0050793	0.713	regulation of developmental process
GO:0006950	0.696	response to stress
GO:0010605	0.691	negative regulation of macromolecule metabolic process
GO:0071900	0.691	regulation of protein serine/threonine kinase activity
GO:0009888	0.661	tissue development
GO:0000082	0.654	G1/S transition of mitotic cell cycle
GO:1901990	0.635	regulation of mitotic cell cycle phase transition
GO:0051347	0.630	positive regulation of transferase activity
GO:0010212	0.624	response to ionizing radiation
GO:0045787	0.608	positive regulation of cell cycle
GO:0035556	0.607	intracellular signal transduction
GO:0009719	0.601	response to endogenous stimulus
GO:0033554	0.593	cellular response to stress
GO:2000045	0.590	regulation of G1/S transition of mitotic cell cycle
GO:0008152	0.587	metabolic process
GO:0031100	0.585	animal organ regeneration
GO:0000079	0.583	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0071704	0.577	organic substance metabolic process
GO:0010165	0.573	response to X-ray
GO:0061008	0.573	hepaticobiliary system development
GO:0051172	0.571	negative regulation of nitrogen compound metabolic process
GO:0048732	0.563	gland development
GO:0033674	0.553	positive regulation of kinase activity
GO:0033993	0.532	response to lipid
GO:0014070	0.529	response to organic cyclic compound
GO:0045860	0.524	positive regulation of protein kinase activity
GO:0044237	0.514	cellular metabolic process
GO:0044238	0.495	primary metabolic process
GO:0071902	0.467	positive regulation of protein serine/threonine kinase activity
GO:0006807	0.462	nitrogen compound metabolic process
GO:0090068	0.445	positive regulation of cell cycle process
GO:0009891	0.437	positive regulation of biosynthetic process
GO:0031327	0.433	negative regulation of cellular biosynthetic process
GO:0010558	0.431	negative regulation of macromolecule biosynthetic process
GO:0010557	0.429	positive regulation of macromolecule biosynthetic process
GO:0070887	0.413	cellular response to chemical stimulus
GO:0045931	0.411	positive regulation of mitotic cell cycle
GO:1901989	0.409	positive regulation of cell cycle phase transition
GO:0045934	0.406	negative regulation of nucleobase-containing compound metabolic process
GO:0043170	0.405	macromolecule metabolic process
GO:1901992	0.385	positive regulation of mitotic cell cycle phase transition
GO:0031328	0.371	positive regulation of cellular biosynthetic process
GO:0048583	0.361	regulation of response to stimulus
GO:0051253	0.356	negative regulation of RNA metabolic process
GO:0009725	0.352	response to hormone
GO:0045892	0.331	negative regulation of DNA-templated transcription
GO:0045935	0.330	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.324	positive regulation of RNA metabolic process
GO:0023051	0.315	regulation of signaling
GO:0009410	0.315	response to xenobiotic stimulus
GO:0051239	0.312	regulation of multicellular organismal process
GO:0009966	0.305	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.995	nucleoplasm
GO:0005829	0.983	cytosol
GO:0032991	0.973	protein-containing complex
GO:1902494	0.849	catalytic complex
GO:1990234	0.747	transferase complex
GO:0061695	0.577	transferase complex, transferring phosphorus-containing groups
GO:0000307	0.461	cyclin-dependent protein kinase holoenzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]