StarFunc result for job id P24394

User Input

>input (825 residues)
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRL
LYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEH
VKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYL
EPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLLLGVSVS
CIVILAVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQDAQGSQWEKRSRGQEPAKCP
HWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTVLWPESISVVR
CVELFEAPVECEEEEEVEEEKGSFCASPESSRDDFQEGREGIVARLTESLFLDLLGEENG
GFCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPD
NLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPT
TVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFVHAVEQGGTQASAVVGLGPPGE
AGYKAFSSLLASSAVSPEKCGFGASSGEEGYKPFQDLIPGCPGDPAPVPVPLFTFGLDRE
PPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVDSLGSGIVYSALTCHL
CGHLKQCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLRAPDPSPGGVPLEASLCPASL
APSGISEKSKSSSSFHPAPGNAQSSSQTPKIVNFVSVGPTYMRVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24394	1.000	1.000	0.000	825	1.000	1.000	P24394.pdb.gz	IL4RA_HUMAN Interleukin-4 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL4R PE=1 SV=1
2	AFDB:P16382	0.359	0.366	5.990E-70	810	0.521	0.531	P16382.pdb.gz	IL4RA_MOUSE Interleukin-4 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il4r PE=1 SV=1
3	AFDB:Q63257	0.375	0.385	2.799E-68	801	0.512	0.527	Q63257.pdb.gz	IL4RA_RAT Interleukin-4 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il4r PE=2 SV=2
4	AFDB:D3ZB51	0.104	0.068	8.295E-13	1328	0.181	0.112	D3ZB51.pdb.gz	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
5	AFDB:F1R2D2	0.128	0.071	8.757E-13	1687	0.125	0.061	F1R2D2.pdb.gz
6	AFDB:Q9W213	0.124	0.081	2.450E-12	1395	0.137	0.081	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
7	PDB:7u7nC	0.188	0.644	3.803E-11	200	0.039	0.160	7u7nC.pdb.gz
8	AFDB:Q4ZHG4	0.140	0.070	4.560E-11	1894	0.137	0.060	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
9	AFDB:A0A0G2JZA1	0.125	0.078	5.364E-11	1512	0.160	0.087	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
10	AFDB:Q2Q0I9	0.144	0.076	9.218E-11	1779	0.142	0.066	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
11	AFDB:A0A338P6S8	0.108	0.057	1.625E-9	1637	0.167	0.084	A0A338P6S8.pdb.gz	A0A338P6S8_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
12	PDB:7z0lB	0.183	0.375	6.173E-9	370	0.044	0.097	7z0lB.pdb.gz
13	PDB:5mj3A	0.178	0.426	8.093E-9	302	0.053	0.146	5mj3A.pdb.gz
14	PDB:3besR	0.167	0.449	5.684E-8	250	0.033	0.108	3besR.pdb.gz
15	PDB:6pxvA	0.129	0.129	2.452E-7	823	0.038	0.038	6pxvA.pdb.gz
16	PDB:8dtlA	0.127	0.139	3.482E-6	741	0.036	0.040	8dtlA.pdb.gz
17	PDB:8eyyA	0.132	0.139	4.096E-6	775	0.036	0.039	8eyyA.pdb.gz
18	PDB:6pyhD	0.123	0.126	4.818E-6	798	0.038	0.039	6pyhD.pdb.gz
19	PDB:7bwaA	0.123	0.146	6.668E-6	674	0.036	0.045	7bwaA.pdb.gz
20	PDB:1seqL	0.086	0.257	2.877E-5	208	0.030	0.120	1seqL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16382	0.0	743	810	0.518	0.527	IL4RA_MOUSE Interleukin-4 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il4r PE=1 SV=1
2	P24394	0.0	1682	825	1.000	1.000	IL4RA_HUMAN Interleukin-4 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL4R PE=1 SV=1
3	Q63257	0.0	732	801	0.505	0.521	IL4RA_RAT Interleukin-4 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il4r PE=2 SV=2
4	P32927	2.81e-12	73.2	897	0.075	0.069	IL3RB_HUMAN Cytokine receptor common subunit beta OS=Homo sapiens OX=9606 GN=CSF2RB PE=1 SV=2
5	A0A8I6GE59	9.01e-06	52.0	787	0.076	0.080	A0A8I6GE59_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=1
6	G3V608	5.33e-05	49.3	896	0.074	0.068	G3V608_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=3
7	Q9HBE5	6.52e-05	48.9	538	0.076	0.117	IL21R_HUMAN Interleukin-21 receptor OS=Homo sapiens OX=9606 GN=IL21R PE=1 SV=1
8	Q9JHX3	7.17e-05	48.5	529	0.069	0.108	IL21R_MOUSE Interleukin-21 receptor OS=Mus musculus OX=10090 GN=Il21r PE=2 SV=1
9	Q78ZF5	1.02e-04	48.5	896	0.059	0.055	Q78ZF5_RAT Interleukin-3 receptor beta-subunit OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=2 SV=1
10	Q5EAS6	1.91e-04	45.8	220	0.035	0.132	Q5EAS6_DANRE Interleukin 4 receptor OS=Danio rerio OX=7955 GN=il4r PE=2 SV=1
11	P26955	5.59e-04	46.2	896	0.079	0.073	IL3RB_MOUSE Cytokine receptor common subunit beta OS=Mus musculus OX=10090 GN=Csf2rb PE=1 SV=2
12	P26954	0.002	44.3	878	0.041	0.039	IL3B2_MOUSE Interleukin-3 receptor class 2 subunit beta OS=Mus musculus OX=10090 GN=Csf2rb2 PE=1 SV=1
13	A0A8I5Y685	0.004	43.1	540	0.038	0.057	A0A8I5Y685_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=1
14	Q6EIY6	0.045	39.7	614	0.050	0.067	Q6EIY6_DANRE Myeloproliferative leukemia virus oncogene, like OS=Danio rerio OX=7955 GN=mpll PE=2 SV=1
15	Q9I8V6	0.12	38.5	1148	0.050	0.036	Q9I8V6_CHICK Leptin receptor OS=Gallus gallus OX=9031 GN=LEPR PE=2 SV=2
16	Q9IBA7	0.13	38.5	1148	0.050	0.036	Q9IBA7_CHICK Leptin receptor OS=Gallus gallus OX=9031 PE=2 SV=1
17	P16871	0.20	37.4	459	0.051	0.092	IL7RA_HUMAN Interleukin-7 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL7R PE=1 SV=3
18	A0A8I6AHK3	0.30	37.0	468	0.081	0.143	A0A8I6AHK3_RAT Interleukin 9 receptor OS=Rattus norvegicus OX=10116 GN=Il9r PE=4 SV=1
19	G3V8S1	0.34	36.6	467	0.081	0.143	G3V8S1_RAT Interleukin 9 receptor OS=Rattus norvegicus OX=10116 GN=Il9r PE=4 SV=1
20	A1Z9J3	0.39	37.0	8805	0.030	0.003	A1Z9J3_DROME Short stop, isoform H OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	1.8e+02	13.8	Fibronectin type III domain
2	PF09238 IL4Ra_N	1.4e-36	136.1	Interleukin-4 receptor alpha chain, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379111

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231449	0.999	Interleukin-4
2	9606.ENSP00000304915	0.999	Interleukin-13
3	9606.ENSP00000360730	0.999	Interleukin-13 receptor subunit alpha-1
4	9606.ENSP00000363318	0.999	Cytokine receptor common subunit gamma
5	9606.ENSP00000300134	0.997	Signal transducer and activator of transcription 6
6	9606.ENSP00000343204	0.985	Tyrosine-protein kinase JAK1
7	9606.ENSP00000391676	0.982	Tyrosine-protein kinase JAK3
8	9606.ENSP00000365016	0.976	Insulin receptor substrate 2
9	9606.ENSP00000391592	0.972	Tyrosine-protein phosphatase non-receptor type 6
10	9606.ENSP00000401303	0.967	SHC-transforming protein 1
11	9606.ENSP00000371067	0.965	Tyrosine-protein kinase JAK2
12	9606.ENSP00000341208	0.959	Signal transducer and activator of transcription 5A
13	9606.ENSP00000304895	0.947	Insulin receptor substrate 1
14	9606.ENSP00000305133	0.947	Suppressor of cytokine signaling 5
15	9606.ENSP00000293328	0.945	Signal transducer and activator of transcription 5B
16	9606.ENSP00000329418	0.941	Suppressor of cytokine signaling 1
17	9606.ENSP00000264072	0.938	Low affinity immunoglobulin epsilon Fc receptor
18	9606.ENSP00000361004	0.938	Interleukin-13 receptor subunit alpha-2
19	9606.ENSP00000405338	0.935	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
20	9606.ENSP00000276420	0.924	Docking protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity
GO:0004913	0.880	interleukin-4 receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0009987	0.999	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0023052	0.994	signaling
GO:0007154	0.994	cell communication
GO:0051716	0.986	cellular response to stimulus
GO:0007165	0.982	signal transduction
GO:0002376	0.980	immune system process
GO:0006955	0.965	immune response
GO:0048518	0.759	positive regulation of biological process
GO:0048522	0.729	positive regulation of cellular process
GO:0019222	0.707	regulation of metabolic process
GO:0006950	0.566	response to stress
GO:0060255	0.538	regulation of macromolecule metabolic process
GO:0009893	0.516	positive regulation of metabolic process
GO:0006952	0.514	defense response
GO:0048583	0.509	regulation of response to stimulus
GO:0042221	0.487	response to chemical
GO:0010604	0.468	positive regulation of macromolecule metabolic process
GO:0051239	0.415	regulation of multicellular organismal process
GO:0032501	0.410	multicellular organismal process
GO:0031323	0.395	regulation of cellular metabolic process
GO:0007166	0.388	cell surface receptor signaling pathway
GO:0010468	0.372	regulation of gene expression
GO:0048519	0.360	negative regulation of biological process
GO:0010033	0.360	response to organic substance
GO:0009605	0.347	response to external stimulus
GO:0002682	0.343	regulation of immune system process
GO:0048584	0.343	positive regulation of response to stimulus
GO:0048523	0.343	negative regulation of cellular process
GO:0042127	0.330	regulation of cell population proliferation
GO:0051240	0.330	positive regulation of multicellular organismal process
GO:0080090	0.327	regulation of primary metabolic process
GO:0051171	0.322	regulation of nitrogen compound metabolic process
GO:0002684	0.311	positive regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.998	protein-containing complex
GO:0005622	0.995	intracellular anatomical structure
GO:0031974	0.991	membrane-enclosed lumen
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0070013	0.978	intracellular organelle lumen
GO:0005634	0.966	nucleus
GO:0005654	0.959	nucleoplasm
GO:0043235	0.915	receptor complex
GO:0005576	0.866	extracellular region
GO:0005856	0.851	cytoskeleton
GO:0015630	0.779	microtubule cytoskeleton
GO:0005815	0.765	microtubule organizing center
GO:0005813	0.756	centrosome
GO:0005737	0.727	cytoplasm
GO:0034451	0.724	centriolar satellite
GO:0005615	0.664	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]