StarFunc result for job id P24468

User Input

>input (414 residues)
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN
CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG
YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1D8R0	0.683	0.683	1.346E-51	414	1.000	1.000	F1D8R0.pdb.gz	F1D8R0_HUMAN Ovalbumin upstream promoter-transcription factor II variant 1 OS=Homo sapiens OX=9606 GN=NR2F2 PE=2 SV=1
2	AFDB:P10589	0.642	0.630	8.811E-47	423	0.884	0.865	P10589.pdb.gz	COT1_HUMAN COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
3	AFDB:B3DGQ7	0.617	0.598	1.047E-46	428	0.879	0.850	B3DGQ7.pdb.gz
4	AFDB:Q6PH18	0.571	0.607	2.267E-43	389	0.795	0.846	Q6PH18.pdb.gz	N2F1B_DANRE Nuclear receptor subfamily 2 group F member 1-B OS=Danio rerio OX=7955 GN=nr2f1b PE=2 SV=1
5	AFDB:P16375	0.699	0.541	3.911E-42	543	0.754	0.575	P16375.pdb.gz	7UP1_DROME Steroid receptor seven-up, isoforms B/C OS=Drosophila melanogaster OX=7227 GN=svp PE=1 SV=1
6	AFDB:Q06726	0.573	0.588	2.611E-41	403	0.739	0.759	Q06726.pdb.gz	NR2F5_DANRE Nuclear receptor subfamily 2 group F member 5 OS=Danio rerio OX=7955 GN=nr2f5 PE=2 SV=1
7	AFDB:P10588	0.573	0.586	1.682E-35	404	0.611	0.626	P10588.pdb.gz	NR2F6_HUMAN Nuclear receptor subfamily 2 group F member 6 OS=Homo sapiens OX=9606 GN=NR2F6 PE=1 SV=2
8	AFDB:P16376	0.453	0.274	2.558E-26	746	0.582	0.323	P16376.pdb.gz	7UP2_DROME Steroid receptor seven-up, isoform A OS=Drosophila melanogaster OX=7227 GN=svp PE=2 SV=3
9	AFDB:Q9Y5X4	0.494	0.499	5.968E-25	410	0.374	0.378	Q9Y5X4.pdb.gz	NR2E3_HUMAN Photoreceptor-specific nuclear receptor OS=Homo sapiens OX=9606 GN=NR2E3 PE=1 SV=1
10	AFDB:F1QGF3	0.453	0.441	1.058E-22	426	0.367	0.357	F1QGF3.pdb.gz
11	PDB:3dzyA	0.372	0.495	2.446E-17	302	0.319	0.437	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:1g2nA	0.392	0.626	1.417E-7	246	0.179	0.301	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
13	PDB:6fx0A	0.417	0.691	3.217E-7	238	0.135	0.235	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
14	PDB:7kw7F	0.287	0.435	1.993E-4	259	0.106	0.170	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7vojA	0.115	0.118	7.683E-2	400	0.097	0.100	7vojA.pdb.gz	Structural basis of ALMT1-mediated aluminum resistance in Arabidopsis.
16	PDB:7p5cA	0.084	0.087	1.821E-1	392	0.072	0.077	7p5cA.pdb.gz
17	PDB:6xz6A	0.164	0.280	2.073E-1	213	0.060	0.117	6xz6A.pdb.gz
18	PDB:7kzqE	0.099	0.098	2.927E-1	419	0.106	0.105	7kzqE.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
19	PDB:7oqzA	0.114	0.170	3.056E-1	237	0.056	0.097	7oqzA.pdb.gz
20	PDB:2xz1A	0.097	0.109	4.134E-1	353	0.106	0.125	2xz1A.pdb.gz	Remote Control of Regioselectivity in Acyl-Acyl Carrier Protein-Desaturases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060YH15	0.0	726	391	0.855	0.905	A0A060YH15_ONCMY COUP transcription factor 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00037055001 PE=3 SV=1
2	A0A1W2Q6N8	0.0	526	273	0.614	0.930	A0A1W2Q6N8_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=4 SV=1
3	A0A8I6A7N1	0.0	742	398	0.877	0.912	A0A8I6A7N1_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=3 SV=1
4	F1D8R0	0.0	861	414	1.000	1.000	F1D8R0_HUMAN Ovalbumin upstream promoter-transcription factor II variant 1 OS=Homo sapiens OX=9606 GN=NR2F2 PE=2 SV=1
5	F1DAL7	0.0	707	372	0.841	0.935	F1DAL7_HUMAN Nuclear receptor subfamily 2 group F member 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
6	F1DAL9	0.0	731	398	0.870	0.905	F1DAL9_HUMAN Nuclear receptor subfamily 2 group F member 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
7	F2Z3S9	0.0	734	420	0.879	0.867	F2Z3S9_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=3 SV=1
8	O09018	0.0	859	414	0.998	0.998	COT2_RAT COUP transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Nr2f2 PE=1 SV=1
9	P10589	0.0	736	423	0.882	0.863	COT1_HUMAN COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
10	P16375	0.0	639	543	0.732	0.558	7UP1_DROME Steroid receptor seven-up, isoforms B/C OS=Drosophila melanogaster OX=7227 GN=svp PE=1 SV=1
11	P24468	0.0	861	414	1.000	1.000	COT2_HUMAN COUP transcription factor 2 OS=Homo sapiens OX=9606 GN=NR2F2 PE=1 SV=1
12	P43135	0.0	861	414	1.000	1.000	COT2_MOUSE COUP transcription factor 2 OS=Mus musculus OX=10090 GN=Nr2f2 PE=1 SV=2
13	Q06725	0.0	733	411	0.872	0.878	N2F1A_DANRE Nuclear receptor subfamily 2 group F member 1-A OS=Danio rerio OX=7955 GN=nr2f1a PE=2 SV=1
14	Q06726	0.0	617	403	0.756	0.777	NR2F5_DANRE Nuclear receptor subfamily 2 group F member 5 OS=Danio rerio OX=7955 GN=nr2f5 PE=2 SV=1
15	Q60632	0.0	735	422	0.882	0.865	COT1_MOUSE COUP transcription factor 1 OS=Mus musculus OX=10090 GN=Nr2f1 PE=2 SV=2
16	Q62681	0.0	726	419	0.874	0.864	Q62681_RAT Orphan receptor COUP-TFI OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=2 SV=1
17	Q6PH18	0.0	672	389	0.802	0.853	N2F1B_DANRE Nuclear receptor subfamily 2 group F member 1-B OS=Danio rerio OX=7955 GN=nr2f1b PE=2 SV=1
18	Q90733	0.0	756	410	0.937	0.946	COT2_CHICK COUP transcription factor 2 OS=Gallus gallus OX=9031 GN=NR2F2 PE=2 SV=1
19	Q91430	0.0	734	422	0.889	0.872	Q91430_DANRE COUP transcription factor 2 OS=Danio rerio OX=7955 GN=svp[40] PE=1 SV=1
20	P16376	8.44e-163	477	746	0.539	0.299	7UP2_DROME Steroid receptor seven-up, isoform A OS=Drosophila melanogaster OX=7227 GN=svp PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	8.7e-34	128.5	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	9.5e-28	107.8	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015072

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000018707	0.924	Estrogen receptor
2	61853.ENSNLEP00000002872	0.743	Nuclear receptor corepressor 2
3	61853.ENSNLEP00000017988	0.711	Nuclear receptor corepressor 1
4	61853.ENSNLEP00000018748	0.620	E1A binding protein p300
5	61853.ENSNLEP00000006740	0.616	MYC proto-oncogene, bHLH transcription factor
6	61853.ENSNLEP00000010638	0.610	Retinoid X receptor, alpha
7	61853.ENSNLEP00000022538	0.610	Mab-21-like 1 (C. elegans)
8	61853.ENSNLEP00000004775	0.583	Zinc finger protein, FOG family member 2
9	61853.ENSNLEP00000000829	0.582	B-cell CLL/lymphoma 11B (zinc finger protein)
10	61853.ENSNLEP00000002093	0.579	Nitric oxide synthase
11	61853.ENSNLEP00000011549	0.577	B-cell CLL/lymphoma 11A (zinc finger protein)
12	61853.ENSNLEP00000019094	0.571	Peroxisome proliferator-activated receptor alpha
13	61853.ENSNLEP00000000991	0.570	Mediator of RNA polymerase II transcription subunit 1
14	61853.ENSNLEP00000014067	0.570	FAT atypical cadherin 1
15	61853.ENSNLEP00000004498	0.566	NFKB inhibitor alpha
16	61853.ENSNLEP00000011440	0.565	Nuclear receptor subfamily 0, group B, member 2
17	61853.ENSNLEP00000010420	0.560	Ubiquitin-conjugating enzyme E2I
18	61853.ENSNLEP00000017553	0.554	Prospero homeobox 1
19	61853.ENSNLEP00000008288	0.541	Retinoid X receptor, beta
20	61853.ENSNLEP00000017861	0.526	Retinoid X receptor, gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	1.000	sequence-specific DNA binding
GO:0005515	0.999	protein binding
GO:0003690	0.990	double-stranded DNA binding
GO:0000981	0.978	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.966	transcription cis-regulatory region binding
GO:0000977	0.716	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.629	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.611	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.368	transcription factor binding
GO:0038023	0.352	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007275	0.997	multicellular organism development
GO:0048731	0.993	system development
GO:0009889	0.988	regulation of biosynthetic process
GO:0009987	0.985	cellular process
GO:0051252	0.985	regulation of RNA metabolic process
GO:0010468	0.982	regulation of gene expression
GO:0010556	0.956	regulation of macromolecule biosynthetic process
GO:0031326	0.956	regulation of cellular biosynthetic process
GO:0006355	0.953	regulation of DNA-templated transcription
GO:0006357	0.914	regulation of transcription by RNA polymerase II
GO:0048518	0.890	positive regulation of biological process
GO:0048519	0.886	negative regulation of biological process
GO:0048523	0.884	negative regulation of cellular process
GO:0048522	0.877	positive regulation of cellular process
GO:0009893	0.825	positive regulation of metabolic process
GO:0010604	0.817	positive regulation of macromolecule metabolic process
GO:0051173	0.813	positive regulation of nitrogen compound metabolic process
GO:0031325	0.807	positive regulation of cellular metabolic process
GO:0050896	0.705	response to stimulus
GO:0048513	0.682	animal organ development
GO:0045935	0.652	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.640	positive regulation of macromolecule biosynthetic process
GO:0031328	0.640	positive regulation of cellular biosynthetic process
GO:0051254	0.626	positive regulation of RNA metabolic process
GO:0045893	0.588	positive regulation of DNA-templated transcription
GO:0030154	0.556	cell differentiation
GO:0009653	0.540	anatomical structure morphogenesis
GO:0045944	0.485	positive regulation of transcription by RNA polymerase II
GO:0010605	0.458	negative regulation of macromolecule metabolic process
GO:0009888	0.450	tissue development
GO:0051172	0.437	negative regulation of nitrogen compound metabolic process
GO:0031324	0.436	negative regulation of cellular metabolic process
GO:0051253	0.431	negative regulation of RNA metabolic process
GO:0010558	0.429	negative regulation of macromolecule biosynthetic process
GO:0045892	0.410	negative regulation of DNA-templated transcription
GO:0051716	0.402	cellular response to stimulus
GO:0000122	0.354	negative regulation of transcription by RNA polymerase II
GO:0007399	0.331	nervous system development
GO:0009887	0.326	animal organ morphogenesis
GO:0072359	0.322	circulatory system development
GO:0042221	0.316	response to chemical
GO:0007154	0.315	cell communication
GO:0023052	0.309	signaling
GO:0048468	0.303	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005829	0.919	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]