StarFunc result for job id P24522

User Input

>input (165 residues)
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24522	1.000	1.000	3.372E-31	165	1.000	1.000	P24522.pdb.gz	GA45A_HUMAN Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
2	PDB:2kg4A	0.792	0.792	1.641E-23	165	1.000	1.000	2kg4A.pdb.gz
3	AFDB:F1R8Z0	0.869	0.911	9.479E-22	157	0.673	0.707	F1R8Z0.pdb.gz	F1R8Z0_DANRE Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Danio rerio OX=7955 GN=gadd45al PE=3 SV=1
4	AFDB:A0A087WZQ0	0.779	0.868	8.925E-21	147	0.891	1.000	A0A087WZQ0.pdb.gz	A0A087WZQ0_HUMAN Growth arrest and DNA damage inducible alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
5	AFDB:O75293	0.891	0.918	1.541E-19	160	0.558	0.575	O75293.pdb.gz	GA45B_HUMAN Growth arrest and DNA damage-inducible protein GADD45 beta OS=Homo sapiens OX=9606 GN=GADD45B PE=1 SV=1
6	AFDB:Q5NU21	0.878	0.914	5.500E-19	158	0.527	0.551	Q5NU21.pdb.gz	Q5NU21_DANRE Gadd45b1 protein OS=Danio rerio OX=7955 GN=gadd45bl PE=2 SV=1
7	AFDB:Q6PC51	0.885	0.918	5.844E-19	159	0.527	0.547	Q6PC51.pdb.gz	Q6PC51_DANRE Gadd45b protein OS=Danio rerio OX=7955 GN=gadd45b PE=2 SV=1
8	AFDB:O95257	0.857	0.888	1.365E-18	159	0.545	0.566	O95257.pdb.gz	GA45G_HUMAN Growth arrest and DNA damage-inducible protein GADD45 gamma OS=Homo sapiens OX=9606 GN=GADD45G PE=1 SV=1
9	PDB:2walA	0.782	0.862	3.617E-17	149	0.515	0.570	2walA.pdb.gz
10	AFDB:A1Z6W5	0.725	0.734	5.519E-10	163	0.248	0.252	A1Z6W5.pdb.gz	A1Z6W5_DROME FI09246p OS=Drosophila melanogaster OX=7227 GN=Gadd45 PE=2 SV=1
11	AFDB:P25398	0.557	0.679	4.609E-6	132	0.224	0.280	P25398.pdb.gz	RS12_HUMAN Small ribosomal subunit protein eS12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3
12	AFDB:O74322	0.554	0.612	9.537E-6	148	0.218	0.243	O74322.pdb.gz	RS12B_SCHPO Small ribosomal subunit protein eS12B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rps1202 PE=3 SV=1
13	PDB:6faiM	0.517	0.659	6.269E-5	125	0.158	0.208	6faiM.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
14	PDB:2aleA	0.582	0.711	1.297E-4	132	0.121	0.152	2aleA.pdb.gz	Analysis of pre-mRNA and pre-rRNA processing factor Snu13p structure and mutants.
15	PDB:6fecr	0.491	0.630	2.527E-4	124	0.236	0.315	6fecr.pdb.gz	Structure of a human cap-dependent 48S translation pre-initiation complex.
16	PDB:3sivA	0.510	0.636	3.635E-4	128	0.145	0.188	3sivA.pdb.gz	Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
17	PDB:5fciC2	0.501	0.647	9.022E-4	124	0.170	0.226	5fciC2.pdb.gz	?
18	PDB:4v6xCG	0.467	0.328	1.018E-3	246	0.139	0.093	4v6xCG.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:5y7mA	0.531	0.677	1.150E-3	125	0.121	0.160	5y7mA.pdb.gz	Crystal structures of the archaeal RNase P protein Rpp38 in complex with RNA fragments containing a K-turn motif.
20	PDB:7azyb	0.463	0.341	3.221E-3	233	0.121	0.086	7azyb.pdb.gz	Context-specific action of macrolide antibiotics on the eukaryotic ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24522	1.07e-120	338	165	1.000	1.000	GA45A_HUMAN Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
2	P48316	6.19e-113	319	165	0.945	0.945	GA45A_MOUSE Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Mus musculus OX=10090 GN=Gadd45a PE=1 SV=1
3	P48317	1.48e-109	310	165	0.921	0.921	GA45A_RAT Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Rattus norvegicus OX=10116 GN=Gadd45a PE=2 SV=1
4	A0A087WZQ0	5.30e-103	293	147	0.891	1.000	A0A087WZQ0_HUMAN Growth arrest and DNA damage inducible alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
5	F1R8Z0	3.67e-72	216	157	0.679	0.713	F1R8Z0_DANRE Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Danio rerio OX=7955 GN=gadd45al PE=3 SV=1
6	O75293	6.20e-61	187	160	0.558	0.575	GA45B_HUMAN Growth arrest and DNA damage-inducible protein GADD45 beta OS=Homo sapiens OX=9606 GN=GADD45B PE=1 SV=1
7	P22339	1.09e-58	182	160	0.545	0.562	GA45B_MOUSE Growth arrest and DNA damage-inducible protein GADD45 beta OS=Mus musculus OX=10090 GN=Gadd45b PE=1 SV=1
8	Q9Z111	2.43e-58	181	159	0.552	0.572	GA45G_MOUSE Growth arrest and DNA damage-inducible protein GADD45 gamma OS=Mus musculus OX=10090 GN=Gadd45g PE=1 SV=1
9	O95257	4.69e-58	180	159	0.552	0.572	GA45G_HUMAN Growth arrest and DNA damage-inducible protein GADD45 gamma OS=Homo sapiens OX=9606 GN=GADD45G PE=1 SV=1
10	Q5NU21	5.68e-54	169	158	0.533	0.557	Q5NU21_DANRE Gadd45b1 protein OS=Danio rerio OX=7955 GN=gadd45bl PE=2 SV=1
11	Q6PC51	5.27e-53	167	159	0.545	0.566	Q6PC51_DANRE Gadd45b protein OS=Danio rerio OX=7955 GN=gadd45b PE=2 SV=1
12	A5JUZ3	2.83e-27	99.0	60	0.297	0.817	A5JUZ3_HUMAN Growth arrest and DNA damage inducible alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
13	A1Z6W5	1.43e-09	55.8	163	0.164	0.166	A1Z6W5_DROME FI09246p OS=Drosophila melanogaster OX=7227 GN=Gadd45 PE=2 SV=1
14	Q8MYS8	1.57e-09	55.8	163	0.164	0.166	Q8MYS8_DROME RH70774p OS=Drosophila melanogaster OX=7227 GN=Gadd45 PE=2 SV=1
15	P25398	5.19e-06	45.8	132	0.236	0.295	RS12_HUMAN Small ribosomal subunit protein eS12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3
16	P63323	5.19e-06	45.8	132	0.236	0.295	RS12_MOUSE Small ribosomal subunit protein eS12 OS=Mus musculus OX=10090 GN=Rps12 PE=1 SV=3
17	P63324	1.81e-04	41.6	132	0.230	0.288	RS12_RAT Small ribosomal subunit protein eS12 OS=Rattus norvegicus OX=10116 GN=Rps12 PE=1 SV=2
18	P80455	6.43e-04	40.0	139	0.164	0.194	RS12_DROME Small ribosomal subunit protein eS12 OS=Drosophila melanogaster OX=7227 GN=RpS12 PE=1 SV=2
19	O74322	0.001	39.7	148	0.206	0.230	RS12B_SCHPO Small ribosomal subunit protein eS12B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rps1202 PE=3 SV=1
20	Q38AC1	0.035	35.4	142	0.164	0.190	Q38AC1_TRYB2 40S ribosomal protein S12 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2050 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01248 Ribosomal_L7Ae	9.2e-15	65.5	Ribosomal protein L7Ae/L30e/S12e/Gadd45 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011265

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000023993	0.994	Cyclin-dependent kinase 1
2	61853.ENSNLEP00000009397	0.987	Proliferating cell nuclear antigen
3	61853.ENSNLEP00000013924	0.980	Mitogen-activated protein kinase kinase kinase 4
4	61853.ENSNLEP00000004906	0.977	Cyclin B1
5	61853.ENSNLEP00000011861	0.976	Cellular tumor antigen p53
6	61853.ENSNLEP00000014073	0.936	Cyclin B2
7	61853.ENSNLEP00000000541	0.928	Growth arrest and DNA-damage-inducible, gamma
8	61853.ENSNLEP00000022745	0.927	Cyclin-dependent kinase inhibitor 1A (p21, Cip1)
9	61853.ENSNLEP00000009939	0.896	Cyclin B3
10	61853.ENSNLEP00000014631	0.778	Breast cancer type 1 susceptibility protein homolog
11	61853.ENSNLEP00000008572	0.777	Aurora kinase A
12	61853.ENSNLEP00000020905	0.772	Cyclin-dependent kinase 4
13	61853.ENSNLEP00000012690	0.764	Cyclin D1
14	61853.ENSNLEP00000003153	0.763	Belongs to the protein kinase superfamily.
15	61853.ENSNLEP00000007943	0.760	thymine-DNA glycosylase
16	61853.ENSNLEP00000015110	0.750	Forkhead box O3
17	61853.ENSNLEP00000015742	0.736	GADD45G interacting protein 1
18	61853.ENSNLEP00000010857	0.702	Mitogen-activated protein kinase 14
19	61853.ENSNLEP00000009727	0.695	Inhibitor of growth family, member 1
20	61853.ENSNLEP00000018748	0.694	E1A binding protein p300

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.890	enzyme binding
GO:0042802	0.806	identical protein binding
GO:0019900	0.506	kinase binding
GO:0003676	0.419	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048519	0.992	negative regulation of biological process
GO:0031399	0.991	regulation of protein modification process
GO:0019220	0.990	regulation of phosphate metabolic process
GO:0009987	0.989	cellular process
GO:0050896	0.981	response to stimulus
GO:0048523	0.976	negative regulation of cellular process
GO:0051338	0.968	regulation of transferase activity
GO:0001932	0.967	regulation of protein phosphorylation
GO:0051716	0.964	cellular response to stimulus
GO:0045859	0.962	regulation of protein kinase activity
GO:0048518	0.961	positive regulation of biological process
GO:0045936	0.961	negative regulation of phosphate metabolic process
GO:0044092	0.958	negative regulation of molecular function
GO:0051248	0.957	negative regulation of protein metabolic process
GO:0051348	0.952	negative regulation of transferase activity
GO:0031400	0.952	negative regulation of protein modification process
GO:0048522	0.951	positive regulation of cellular process
GO:0042326	0.951	negative regulation of phosphorylation
GO:0033673	0.941	negative regulation of kinase activity
GO:0048583	0.933	regulation of response to stimulus
GO:0001933	0.918	negative regulation of protein phosphorylation
GO:0006469	0.913	negative regulation of protein kinase activity
GO:0010594	0.911	regulation of endothelial cell migration
GO:0006950	0.893	response to stress
GO:0023051	0.875	regulation of signaling
GO:1902531	0.847	regulation of intracellular signal transduction
GO:0051726	0.845	regulation of cell cycle
GO:1902533	0.840	positive regulation of intracellular signal transduction
GO:0033135	0.839	regulation of peptidyl-serine phosphorylation
GO:0008152	0.837	metabolic process
GO:0043535	0.836	regulation of blood vessel endothelial cell migration
GO:0080135	0.813	regulation of cellular response to stress
GO:0006974	0.802	cellular response to DNA damage stimulus
GO:0009893	0.744	positive regulation of metabolic process
GO:0044238	0.728	primary metabolic process
GO:0071704	0.724	organic substance metabolic process
GO:0007154	0.705	cell communication
GO:0023052	0.654	signaling
GO:0022402	0.651	cell cycle process
GO:0010941	0.643	regulation of cell death
GO:0044237	0.640	cellular metabolic process
GO:0007165	0.629	signal transduction
GO:0043067	0.627	regulation of programmed cell death
GO:0042981	0.617	regulation of apoptotic process
GO:0010468	0.613	regulation of gene expression
GO:0006807	0.611	nitrogen compound metabolic process
GO:0043170	0.606	macromolecule metabolic process
GO:0010604	0.596	positive regulation of macromolecule metabolic process
GO:0043410	0.588	positive regulation of MAPK cascade
GO:0019219	0.586	regulation of nucleobase-containing compound metabolic process
GO:0071900	0.581	regulation of protein serine/threonine kinase activity
GO:0032872	0.573	regulation of stress-activated MAPK cascade
GO:0009889	0.569	regulation of biosynthetic process
GO:0010556	0.564	regulation of macromolecule biosynthetic process
GO:0032874	0.548	positive regulation of stress-activated MAPK cascade
GO:1900744	0.547	regulation of p38MAPK cascade
GO:0031326	0.545	regulation of cellular biosynthetic process
GO:0051173	0.538	positive regulation of nitrogen compound metabolic process
GO:0035556	0.523	intracellular signal transduction
GO:0030336	0.487	negative regulation of cell migration
GO:0031325	0.443	positive regulation of cellular metabolic process
GO:0051241	0.425	negative regulation of multicellular organismal process
GO:0010596	0.422	negative regulation of endothelial cell migration
GO:1903506	0.406	regulation of nucleic acid-templated transcription
GO:0006355	0.403	regulation of DNA-templated transcription
GO:0071840	0.376	cellular component organization or biogenesis
GO:0016043	0.334	cellular component organization
GO:0012501	0.319	programmed cell death
GO:0043065	0.311	positive regulation of apoptotic process
GO:0006139	0.306	nucleobase-containing compound metabolic process
GO:0044260	0.304	cellular macromolecule metabolic process
GO:0090304	0.304	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.970	cytoplasm
GO:0016604	0.622	nuclear body
GO:0032991	0.460	protein-containing complex
GO:0005829	0.422	cytosol
GO:0016607	0.303	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]