StarFunc result for job id P24539

User Input

>input (256 residues)
MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIP
EEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFV
ADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEV
TYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCI
ADLKLLAKKAQAQPVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24539	1.000	1.000	5.121E-36	256	1.000	1.000	P24539.pdb.gz	AT5F1_HUMAN ATP synthase F(0) complex subunit B1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PB PE=1 SV=2
2	AFDB:P13619	0.862	0.862	2.261E-30	256	0.867	0.867	P13619.pdb.gz	AT5F1_BOVIN ATP synthase F(0) complex subunit B1, mitochondrial OS=Bos taurus OX=9913 GN=ATP5PB PE=1 SV=2
3	AFDB:P19511	0.816	0.816	2.425E-30	256	0.820	0.820	P19511.pdb.gz	AT5F1_RAT ATP synthase F(0) complex subunit B1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5pb PE=1 SV=1
4	AFDB:Q94516	0.717	0.751	1.256E-14	243	0.402	0.424	Q94516.pdb.gz	AT5F1_DROME ATP synthase subunit b, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsynB PE=2 SV=2
5	AFDB:Q20053	0.473	0.411	5.335E-7	301	0.172	0.146	Q20053.pdb.gz	AT5F1_CAEEL ATP synthase F(0) complex subunit B1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=asb-1 PE=2 SV=1
6	AFDB:P05626	0.483	0.503	3.613E-5	244	0.199	0.209	P05626.pdb.gz	ATPF_YEAST ATP synthase subunit 4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP4 PE=1 SV=2
7	AFDB:O94373	0.599	0.625	2.409E-4	244	0.203	0.213	O94373.pdb.gz	ATPF_SCHPO ATP synthase subunit 4, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp4 PE=3 SV=1
8	AFDB:Q59ZE0	0.583	0.633	3.730E-3	233	0.168	0.185	Q59ZE0.pdb.gz	Q59ZE0_CANAL ATP synthase subunit 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATP4 PE=3 SV=1
9	AFDB:Q9M0I6	0.151	0.117	4.132E-1	348	0.113	0.083	Q9M0I6.pdb.gz	Q9M0I6_ARATH At4g28210 OS=Arabidopsis thaliana OX=3702 GN=EMB1923 PE=1 SV=1
10	AFDB:Q385Z2	0.238	0.250	6.298E-1	240	0.133	0.142	Q385Z2.pdb.gz	Q385Z2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1750 PE=4 SV=1
11	PDB:7enag	0.168	0.246	8.305	166	0.137	0.211	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
12	PDB:3epyA	0.099	0.206	8.909	88	0.043	0.125	3epyA.pdb.gz	Crystal Structure of human acyl-CoA binding domain 7 complexed with palmitoyl-Coa

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24539	0.0	528	256	1.000	1.000	AT5F1_HUMAN ATP synthase F(0) complex subunit B1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PB PE=1 SV=2
2	Q08ET0	0.0	528	256	1.000	1.000	Q08ET0_HUMAN ATP synthase subunit b OS=Homo sapiens OX=9606 GN=hCG_39985 PE=2 SV=1
3	P13619	6.14e-163	453	256	0.867	0.867	AT5F1_BOVIN ATP synthase F(0) complex subunit B1, mitochondrial OS=Bos taurus OX=9913 GN=ATP5PB PE=1 SV=2
4	Q9CQQ7	1.09e-151	424	256	0.828	0.828	AT5F1_MOUSE ATP synthase F(0) complex subunit B1, mitochondrial OS=Mus musculus OX=10090 GN=Atp5pb PE=1 SV=1
5	P19511	2.69e-151	424	256	0.820	0.820	AT5F1_RAT ATP synthase F(0) complex subunit B1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5pb PE=1 SV=1
6	Q5QNZ2	1.11e-133	377	195	0.711	0.933	Q5QNZ2_HUMAN ATP synthase subunit b OS=Homo sapiens OX=9606 GN=ATP5PB PE=1 SV=1
7	Q94516	1.61e-62	198	243	0.375	0.395	AT5F1_DROME ATP synthase subunit b, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsynB PE=2 SV=2
8	P05626	2.07e-08	55.8	244	0.156	0.164	ATPF_YEAST ATP synthase subunit 4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP4 PE=1 SV=2
9	Q20053	7.05e-08	54.7	301	0.184	0.156	AT5F1_CAEEL ATP synthase F(0) complex subunit B1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=asb-1 PE=2 SV=1
10	O94373	0.001	42.0	244	0.156	0.164	ATPF_SCHPO ATP synthase subunit 4, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp4 PE=3 SV=1
11	Q9T093	0.95	33.1	518	0.129	0.064	C70B3_ARATH Cytochrome P450 709B3 OS=Arabidopsis thaliana OX=3702 GN=CYP709B3 PE=2 SV=1
12	Q03001	2.5	32.0	7570	0.125	0.004	DYST_HUMAN Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=4
13	F8W9J4	2.6	32.0	7461	0.125	0.004	F8W9J4_HUMAN Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=1
14	Q381K1	4.5	31.2	754	0.125	0.042	Q381K1_TRYB2 Kinteoplast poly(A) polymerase complex 1 subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7510 PE=4 SV=1
15	O65359	4.6	30.8	322	0.074	0.059	SYP41_ARATH Tlg2p-like protein a OS=Arabidopsis thaliana OX=3702 GN=SYP41 PE=1 SV=1
16	Q384Y0	5.4	30.8	1048	0.094	0.023	PIF2_TRYB2 ATP-dependent DNA helicase PIF2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=PIF2 PE=1 SV=1
17	O02482	5.5	30.8	612	0.086	0.036	UNC37_CAEEL Transcription factor unc-37 OS=Caenorhabditis elegans OX=6239 GN=unc-37 PE=1 SV=1
18	Q9LVI9	6.2	30.4	426	0.059	0.035	DPYD_ARATH Dihydropyrimidine dehydrogenase (NADP(+)), chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PYD1 PE=1 SV=1
19	Q9VCA8	6.3	30.8	4001	0.090	0.006	ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster OX=7227 GN=mask PE=1 SV=2
20	B1AKZ5	6.4	29.3	108	0.086	0.204	B1AKZ5_HUMAN Proliferation and apoptosis adaptor protein 15 OS=Homo sapiens OX=9606 GN=PEA15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09878 DUF2105	2.7e+02	12.7	Predicted membrane protein (DUF2105)
2	PF05405 Mt_ATP-synt_B	1.1e-42	156.9	Mitochondrial ATP synthase B chain precursor (ATP-synt_B)
3	PF07812 TfuA	8.3e+02	11.1	TfuA-like protein
4	PF09679 TraQ	34	15.8	Type-F conjugative transfer system pilin chaperone (TraQ)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358737

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215375	0.999	ATP synthase subunit delta, mitochondrial
2	9606.ENSP00000262030	0.999	ATP synthase subunit beta, mitochondrial
3	9606.ENSP00000284727	0.999	ATP synthase F(0) complex subunit C3, mitochondrial
4	9606.ENSP00000290299	0.999	ATP synthase subunit O, mitochondrial
5	9606.ENSP00000292475	0.999	ATP synthase subunit f, mitochondrial
6	9606.ENSP00000300688	0.999	ATP synthase subunit g, mitochondrial
7	9606.ENSP00000301587	0.999	ATP synthase subunit d, mitochondrial
8	9606.ENSP00000306003	0.999	ATP synthase subunit e, mitochondrial
9	9606.ENSP00000349142	0.999	ATP synthase subunit gamma, mitochondrial
10	9606.ENSP00000381736	0.999	ATP synthase subunit alpha, mitochondrial
11	9606.ENSP00000389649	0.999	ATP synthase-coupling factor 6, mitochondrial
12	9606.ENSP00000243997	0.998	ATP synthase subunit epsilon, mitochondrial
13	9606.ENSP00000354632	0.998	ATP synthase subunit a
14	9606.ENSP00000355265	0.998	ATP synthase protein 8
15	9606.ENSP00000377033	0.997	ATP synthase F(0) complex subunit C1, mitochondrial
16	9606.ENSP00000358840	0.996	Up-regulated during skeletal muscle growth protein 5
17	9606.ENSP00000421076	0.996	ATP synthase subunit g 2, mitochondrial
18	9606.ENSP00000268379	0.995	Cytochrome b-c1 complex subunit 2, mitochondrial
19	9606.ENSP00000276689	0.994	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
20	9606.ENSP00000306397	0.993	Cytochrome b-c1 complex subunit Rieske, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046933	0.999	proton-transporting ATP synthase activity, rotational mechanism
GO:0140657	0.934	ATP-dependent activity
GO:0016817	0.925	hydrolase activity, acting on acid anhydrides
GO:0017111	0.915	ribonucleoside triphosphate phosphatase activity
GO:0016887	0.912	ATP hydrolysis activity
GO:0044877	0.753	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.988	cellular metabolic process
GO:0071704	0.960	organic substance metabolic process
GO:0009117	0.935	nucleotide metabolic process
GO:0009205	0.932	purine ribonucleoside triphosphate metabolic process
GO:0009150	0.931	purine ribonucleotide metabolic process
GO:0046034	0.918	ATP metabolic process
GO:0006091	0.767	generation of precursor metabolites and energy
GO:0009060	0.730	aerobic respiration
GO:0009058	0.564	biosynthetic process
GO:0006119	0.499	oxidative phosphorylation
GO:0044249	0.464	cellular biosynthetic process
GO:1901576	0.451	organic substance biosynthetic process
GO:0009152	0.425	purine ribonucleotide biosynthetic process
GO:0006754	0.405	ATP biosynthetic process
GO:0032502	0.346	developmental process
GO:0032501	0.345	multicellular organismal process
GO:0048856	0.338	anatomical structure development
GO:0015986	0.320	proton motive force-driven ATP synthesis
GO:0007275	0.314	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.997	catalytic complex
GO:0098800	0.997	inner mitochondrial membrane protein complex
GO:0016469	0.980	proton-transporting two-sector ATPase complex
GO:0005753	0.971	mitochondrial proton-transporting ATP synthase complex
GO:0005634	0.915	nucleus
GO:0031981	0.397	nuclear lumen
GO:0000276	0.306	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:57720	0.999	ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate
EC:7.1.2.2	0.999	H(+)-transporting two-sector ATPase.
EC:3.6.-.-	0.925	Acting on acid anhydrides.
RHEA:23680	0.915	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.915	nucleoside-triphosphate phosphatase.
RHEA:13065	0.912	ATP + H2O = ADP + H(+) + phosphate

[back to server]