StarFunc result for job id P24588

User Input

>input (427 residues)
METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVAR
KCPQEAGASDQPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKK
AKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQ
DLSEGISRKDGDEVCESNVSNSTTSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQ
DVQPQQASPLETSETDHQQPVLSDVPPLPAIPDQQIVEEASNSTLESAPNGKDYESTEIV
AEETKPKDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEFDVTKSKNVPK
QFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
KINNLLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24588	1.000	1.000	3.553E-57	427	1.000	1.000	P24588.pdb.gz	AKAP5_HUMAN A-kinase anchor protein 5 OS=Homo sapiens OX=9606 GN=AKAP5 PE=1 SV=3
2	AFDB:F1SA75	0.212	0.212	7.887E-41	427	0.782	0.782	F1SA75.pdb.gz	F1SA75_PIG A-kinase anchoring protein 5 OS=Sus scrofa OX=9823 GN=AKAP5 PE=1 SV=1
3	AFDB:Q6FY22	0.081	0.054	2.224E-1	694	0.141	0.086	Q6FY22.pdb.gz	SEC9_CANGA Protein transport protein SEC9 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SEC9 PE=3 SV=1
4	AFDB:Q13615	0.085	0.033	5.158E-1	1198	0.150	0.053	Q13615.pdb.gz	MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens OX=9606 GN=MTMR3 PE=1 SV=3
5	AFDB:A0A024RDC4	0.069	0.053	7.854E-1	689	0.126	0.078	A0A024RDC4.pdb.gz
6	AFDB:P33304	0.077	0.055	9.036E-1	620	0.126	0.087	P33304.pdb.gz	AFR1_YEAST Protein AFR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AFR1 PE=1 SV=1
7	AFDB:Q8WTI7	0.079	0.037	9.692E-1	1041	0.145	0.060	Q8WTI7.pdb.gz	Q8WTI7_DROME PFTAIRE-interacting factor 1B OS=Drosophila melanogaster OX=7227 GN=Pif1B PE=1 SV=1
8	AFDB:Q0WV37	0.072	0.057	1.040	577	0.105	0.078	Q0WV37.pdb.gz	HIP34_ARATH Heavy metal-associated isoprenylated plant protein 34 OS=Arabidopsis thaliana OX=3702 GN=HIPP34 PE=2 SV=1
9	AFDB:C9JF13	0.056	0.030	1.115	903	0.162	0.076	C9JF13.pdb.gz	C9JF13_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
10	AFDB:E9Q7M2	0.078	0.050	1.376	769	0.192	0.107	E9Q7M2.pdb.gz	T22D2_MOUSE TSC22 domain family protein 2 OS=Mus musculus OX=10090 GN=Tsc22d2 PE=1 SV=1
11	PDB:7ajtCL	0.095	0.056	8.931	781	0.028	0.015	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:5mrcB	0.052	0.067	9.580	321	0.016	0.022	5mrcB.pdb.gz	The structure of the yeast mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SA75	0.0	640	427	0.782	0.782	F1SA75_PIG A-kinase anchoring protein 5 OS=Sus scrofa OX=9823 GN=AKAP5 PE=1 SV=1
2	P24588	0.0	860	427	1.000	1.000	AKAP5_HUMAN A-kinase anchor protein 5 OS=Homo sapiens OX=9606 GN=AKAP5 PE=1 SV=3
3	D3YVF0	1.83e-86	280	745	0.398	0.228	AKAP5_MOUSE A-kinase anchor protein 5 OS=Mus musculus OX=10090 GN=Akap5 PE=1 SV=2
4	P24587	6.10e-66	225	714	0.379	0.227	AKAP5_RAT A-kinase anchor protein 5 OS=Rattus norvegicus OX=10116 GN=Akap5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03832 WSK	6.8e-08	43.4	WSK motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378207

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265717	0.998	cAMP-dependent protein kinase type II-beta regulatory subunit
2	9606.ENSP00000345731	0.998	Disks large homolog 1
3	9606.ENSP00000382428	0.998	Disks large homolog 4
4	9606.ENSP00000408695	0.994	Protein kinase C alpha type
5	9606.ENSP00000419361	0.991	Adenylate cyclase type 5
6	9606.ENSP00000305372	0.989	Beta-2 adrenergic receptor
7	9606.ENSP00000266376	0.987	Voltage-dependent L-type calcium channel subunit alpha-1C
8	9606.ENSP00000268182	0.985	Ras GTPase-activating-like protein IQGAP1
9	9606.ENSP00000459962	0.984	Transient receptor potential cation channel, subfamily V, member 1
10	9606.ENSP00000428994	0.978	Glutamate receptor 1
11	9606.ENSP00000311405	0.972	Adenylate cyclase type 6
12	9606.ENSP00000265563	0.967	cAMP-dependent protein kinase type II-alpha regulatory subunit
13	9606.ENSP00000286355	0.965	Adenylate cyclase type 8
14	9606.ENSP00000300105	0.956	Voltage-dependent calcium channel gamma-2 subunit
15	9606.ENSP00000461007	0.956	Transient receptor potential cation channel subfamily V member 1
16	9606.ENSP00000309591	0.950	cAMP-dependent protein kinase catalytic subunit alpha
17	9606.ENSP00000349467	0.942	Calmodulin-1
18	9606.ENSP00000337168	0.936	Band 4.1-like protein 1
19	9606.ENSP00000317310	0.931	Calcium-binding protein 1
20	9606.ENSP00000481554	0.925	Glutamate receptor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0097110	1.000	scaffold protein binding
GO:0035254	1.000	glutamate receptor binding
GO:0034237	1.000	protein kinase A regulatory subunit binding
GO:0017124	1.000	SH3 domain binding
GO:0008179	1.000	adenylate cyclase binding
GO:0030346	1.000	protein phosphatase 2B binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0050896	0.989	response to stimulus
GO:0023052	0.984	signaling
GO:0007154	0.982	cell communication
GO:0051716	0.976	cellular response to stimulus
GO:0032879	0.954	regulation of localization
GO:0007165	0.954	signal transduction
GO:0010646	0.953	regulation of cell communication
GO:0023051	0.951	regulation of signaling
GO:0065008	0.936	regulation of biological quality
GO:0048518	0.936	positive regulation of biological process
GO:0065009	0.921	regulation of molecular function
GO:0048522	0.921	positive regulation of cellular process
GO:0051049	0.879	regulation of transport
GO:1905475	0.746	regulation of protein localization to membrane
GO:0048583	0.717	regulation of response to stimulus
GO:0050790	0.697	regulation of catalytic activity
GO:0009966	0.650	regulation of signal transduction
GO:1904375	0.642	regulation of protein localization to cell periphery
GO:0051339	0.605	regulation of lyase activity
GO:0048167	0.586	regulation of synaptic plasticity
GO:1900271	0.575	regulation of long-term synaptic potentiation
GO:1903829	0.519	positive regulation of protein localization
GO:0007186	0.515	G protein-coupled receptor signaling pathway
GO:1905477	0.484	positive regulation of protein localization to membrane
GO:1904377	0.479	positive regulation of protein localization to cell periphery
GO:0031279	0.461	regulation of cyclase activity
GO:0007188	0.408	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0051050	0.398	positive regulation of transport
GO:0007267	0.364	cell-cell signaling
GO:1903076	0.321	regulation of protein localization to plasma membrane
GO:0045761	0.305	regulation of adenylate cyclase activity
GO:1903078	0.302	positive regulation of protein localization to plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043226	0.978	organelle
GO:0043229	0.973	intracellular organelle
GO:0043227	0.968	membrane-bounded organelle
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0005829	0.944	cytosol
GO:0012505	0.924	endomembrane system
GO:0031982	0.827	vesicle
GO:0031410	0.754	cytoplasmic vesicle
GO:0030054	0.737	cell junction
GO:0045202	0.661	synapse
GO:0098794	0.521	postsynapse
GO:0005634	0.458	nucleus
GO:0045121	0.392	membrane raft
GO:0005768	0.392	endosome
GO:0098837	0.366	postsynaptic recycling endosome
GO:0098552	0.337	side of membrane
GO:0009898	0.317	cytoplasmic side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]